Project name: a431fa7e0c65533

Status: done

Started: 2026-07-01 15:22:21
Settings
Chain sequence(s) B: SSPLAEELDRRRNAALSAQLSAALQASQEDMTLAWRVDGERVALARVVRL
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:27)
Show buried residues

Minimal score value
-4.8043
Maximal score value
1.3826
Average score
-1.3293
Total score value
-66.4674

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.5165
2 S B -0.3481
3 P B -0.4702
4 L B 0.2555
5 A B -1.2415
6 E B -3.1106
7 E B -2.8017
8 L B -2.7248
9 D B -4.6068
10 R B -4.8043
11 R B -4.5941
12 R B -4.3222
13 N B -3.4803
14 A B -2.2073
15 A B -1.4345
16 L B -0.1795
17 S B -0.3852
18 A B -0.2826
19 Q B -0.6368
20 L B 0.2432
21 S B -0.3063
22 A B -0.4465
23 A B -0.3737
24 L B -1.0562
25 Q B -1.6584
26 A B -0.9294
27 S B -1.7887
28 Q B -2.5527
29 E B -3.1301
30 D B -2.6851
31 M B -1.4460
32 T B -0.3651
33 L B 0.3800
34 A B 0.4121
35 W B 0.6079
36 R B -2.0739
37 V B -1.4125
38 D B -2.6954
39 G B -2.5989
40 E B -3.2053
41 R B -2.2252
42 V B 0.3003
43 A B 1.0285
44 L B 1.3826
45 A B 0.4978
46 R B -1.2824
47 V B -0.4973
48 V B -0.4033
49 R B -1.1352
50 L B 0.8393
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018