Project name: a44f24651fc03d4

Status: done

Started: 2026-07-01 15:24:43
Settings
Chain sequence(s) B: APQSTRFALLARGPLEKVGQRIATATVLGAGLQAVSISVSGGVVTVTLRG
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:11)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:12)
Show buried residues

Minimal score value
-1.8236
Maximal score value
2.9727
Average score
0.141
Total score value
7.0515

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A B -0.2872
2 P B -0.4726
3 Q B -1.1966
4 S B -0.5270
5 T B -0.8819
6 R B -1.4625
7 F B -0.0717
8 A B 0.2635
9 L B 1.0615
10 L B 0.9346
11 A B -0.3455
12 R B -1.7904
13 G B -0.9390
14 P B -0.4314
15 L B 0.5428
16 E B -1.0528
17 K B -1.3751
18 V B 0.1030
19 G B -0.9125
20 Q B -1.3938
21 R B -0.7920
22 I B 1.1622
23 A B 0.8960
24 T B 0.1372
25 A B -0.0156
26 T B -0.1701
27 V B 0.4925
28 L B 0.9501
29 G B 0.0681
30 A B -0.6874
31 G B -1.1424
32 L B -0.8881
33 Q B -1.3186
34 A B 0.3517
35 V B 1.4378
36 S B 1.4335
37 I B 2.9727
38 S B 2.1594
39 V B 2.6284
40 S B 0.9359
41 G B 0.1848
42 G B 0.6006
43 V B 2.1298
44 V B 2.4409
45 T B 1.8951
46 V B 2.0500
47 T B 0.8187
48 L B -0.2045
49 R B -1.8236
50 G B -1.4170
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018