Project name: a47a46d5d6cc425

Status: done

Started: 2026-03-26 02:12:10
Settings
Chain sequence(s) A: SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)
Show buried residues

Minimal score value
-1.9286
Maximal score value
2.6647
Average score
0.6355
Total score value
19.0642

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A 0.7858
2 I A 1.4967
3 I A 1.1513
4 G A 1.3194
5 I A 2.6647
6 I A 2.3110
7 M A 1.6514
8 G A 1.3895
9 I A 2.4938
10 L A 1.5895
11 G A 0.2435
12 N A -0.6718
13 I A 0.2200
14 P A -0.5189
15 Q A -0.6756
16 V A 0.8143
17 I A 0.9551
18 Q A -0.0095
19 I A 1.3424
20 I A 1.5773
21 M A 1.0549
22 S A 0.7677
23 I A 2.1361
24 V A 0.0000
25 K A -0.9721
26 A A -0.0069
27 F A 0.9345
28 K A -1.4263
29 G A -1.6250
30 N A -1.9286
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018