Project name: a49832e988da699

Status: done

Started: 2026-06-22 16:07:30
Settings
Chain sequence(s) B: ELRALMDEMIEGLKKQQEISEKLWEANGDEEGKKKAKEFLKKLIDKVKEY
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:34)
Show buried residues

Minimal score value
-4.7585
Maximal score value
0.0
Average score
-2.5011
Total score value
-125.0534

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E B -1.9676
2 L B -1.2273
3 R B -2.5105
4 A B -1.8174
5 L B -1.0751
6 M B 0.0000
7 D B -3.4616
8 E B -3.0361
9 M B -1.8858
10 I B -2.7724
11 E B -3.6945
12 G B -2.8673
13 L B -2.4011
14 K B -3.5456
15 K B -3.4036
16 Q B -2.8184
17 Q B -2.9243
18 E B -2.8684
19 I B -0.9685
20 S B -1.5881
21 E B -3.2150
22 K B -2.3388
23 L B -0.6035
24 W B -2.7043
25 E B -3.4731
26 A B -2.0088
27 N B -2.5642
28 G B -2.8499
29 D B -3.6375
30 E B -4.7585
31 E B -4.4935
32 G B 0.0000
33 K B -4.6627
34 K B -4.6374
35 K B -4.0154
36 A B -3.0382
37 K B -4.0395
38 E B -3.2706
39 F B -0.9695
40 L B 0.0000
41 K B -2.8295
42 K B -2.8966
43 L B -1.8234
44 I B 0.0000
45 D B -3.0019
46 K B -3.3485
47 V B 0.0000
48 K B -3.4800
49 E B -2.7278
50 Y B -0.8317
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018