Project name: query_structure

Status: done

Started: 2026-03-16 21:42:26
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFIIVYRENIETGEAIVLTVPGSERSYDLTGLKPGTEYYVQIAGVKGGNISFPLSAIFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:40)
Show buried residues

Minimal score value
-3.1336
Maximal score value
2.298
Average score
-0.5654
Total score value
-50.8831

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.4731
2 L A 1.0328
3 P A 0.5074
4 A A 0.5358
5 P A 0.0000
6 K A -1.9852
7 N A -1.2476
8 L A -0.0458
9 V A 1.4103
10 V A 0.7519
11 S A -0.6035
12 R A -2.0446
13 V A -1.0968
14 T A -1.8277
15 E A -3.1008
16 D A -2.8238
17 S A -2.1273
18 A A 0.0000
19 R A -1.2107
20 L A 0.0000
21 S A -0.3010
22 W A 0.0000
23 T A -1.2661
24 A A -1.4234
25 P A -1.3684
26 D A -2.2601
27 A A -1.4440
28 A A -1.1988
29 F A 0.0000
30 D A -2.6478
31 S A -1.1913
32 F A 0.0000
33 I A 1.0224
34 I A 0.0000
35 V A 0.9579
36 Y A 0.5436
37 R A -0.9398
38 E A -2.0105
39 N A -1.6699
40 I A -0.4704
41 E A -1.9486
42 T A -1.5202
43 G A 0.0000
44 E A -1.9069
45 A A -0.2477
46 I A 0.9635
47 V A 2.0725
48 L A 1.4440
49 T A 0.5874
50 V A 0.0000
51 P A -1.0838
52 G A 0.0000
53 S A -1.6006
54 E A -1.5579
55 R A -1.1691
56 S A -0.6627
57 Y A -0.7857
58 D A -1.6656
59 L A 0.0000
60 T A -1.3713
61 G A -1.5271
62 L A 0.0000
63 K A -3.1336
64 P A -2.5517
65 G A -1.8610
66 T A -2.1386
67 E A -1.4499
68 Y A 0.0000
69 Y A 0.4735
70 V A 0.0000
71 Q A 0.5111
72 I A 0.0000
73 A A 0.0000
74 G A 0.0000
75 V A -0.5413
76 K A -1.8759
77 G A -1.6482
78 G A -1.4448
79 N A -0.9576
80 I A 1.1624
81 S A 0.0000
82 F A 2.2980
83 P A 0.9330
84 L A 0.1247
85 S A 0.7839
86 A A 1.2874
87 I A 1.9246
88 F A 0.0000
89 T A -0.8021
90 T A -1.9271
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018