Project name: query_structure

Chain sequence(s)	A: CGETCFTGTCYTNGCTCDPWPVCTRNGLPV
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:12)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:12)

• Minimal score value: -1.4269
• Maximal score value: 2.1187
• Average score: 0.129
• Total score value: 3.8703

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	C	A	0.2267
2	G	A	-0.1648
3	E	A	0.1108
4	T	A	0.7491
5	C	A	0.0000
6	F	A	2.1187
7	T	A	1.0184
8	G	A	0.4778
9	T	A	0.5606
10	C	A	0.5872
11	Y	A	0.8990
12	T	A	-0.2706
13	N	A	-1.2430
14	G	A	-1.4269
15	C	A	-0.8545
16	T	A	-0.7679
17	C	A	-0.1559
18	D	A	-1.3507
19	P	A	-0.1388
20	W	A	1.1824
21	P	A	1.2408
22	V	A	0.8199
23	C	A	0.0000
24	T	A	0.0000
25	R	A	-0.9764
26	N	A	-1.2160
27	G	A	-0.6973
28	L	A	0.9274
29	P	A	0.6013
30	V	A	1.6130