Project name: query_structure

Status: done

Started: 2026-03-16 22:55:59
Settings
Chain sequence(s) A: AMHVAQPAVVLASSRGIASFVCEYAAGCKNFFWKTFTSCATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:54)
Show buried residues

Minimal score value
-2.5073
Maximal score value
2.7331
Average score
-0.262
Total score value
-35.3691

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.7045
2 M A 0.3237
3 H A -0.6015
4 V A 0.0000
5 A A -0.5373
6 Q A -0.1671
7 P A 0.1974
8 A A 0.4829
9 V A 1.9109
10 V A 1.6593
11 L A 2.3718
12 A A 0.0000
13 S A -0.2703
14 S A -1.3424
15 R A -2.3537
16 G A 0.0000
17 I A -0.6415
18 A A 0.0000
19 S A -0.0668
20 F A 0.0000
21 V A -0.2779
22 C A 0.0000
23 E A -1.4496
24 Y A 0.0000
25 A A -0.8535
26 A A -0.7902
27 G A -0.4792
28 C A -0.2870
29 K A -1.2004
30 N A 0.1429
31 F A 2.1269
32 F A 2.7331
33 W A 1.8962
34 K A 0.1694
35 T A 1.1022
36 F A 2.0137
37 T A 0.6857
38 S A 0.2933
39 C A 0.2179
40 A A 0.0000
41 T A 0.1994
42 E A -0.1653
43 V A 0.0000
44 R A -0.7302
45 V A 0.0000
46 T A 0.0000
47 V A 0.0000
48 L A -0.2169
49 R A -0.6589
50 Q A -0.8651
51 A A -1.0544
52 D A -2.1084
53 S A -1.4281
54 Q A -1.4890
55 V A -0.0963
56 T A -0.6268
57 E A -1.5216
58 V A -0.5478
59 C A 0.0000
60 A A -0.4331
61 A A 0.0000
62 T A -0.3250
63 Y A 0.0000
64 M A -0.5016
65 M A -0.7619
66 G A -1.4742
67 N A -2.2862
68 E A -2.5073
69 L A 0.0000
70 T A -0.4983
71 F A -0.1082
72 L A 0.3856
73 D A -1.7089
74 D A -2.1566
75 S A -1.1032
76 I A -0.5512
77 C A 0.0000
78 T A -0.4578
79 G A -0.7467
80 T A -1.2825
81 S A -1.4708
82 S A -1.5017
83 G A -1.0248
84 N A -1.1158
85 Q A -1.5231
86 V A 0.0000
87 N A -1.2104
88 L A 0.0000
89 T A -0.2708
90 I A 0.0000
91 Q A -1.0792
92 G A -1.3695
93 L A 0.0000
94 R A -1.9361
95 A A -0.3886
96 M A 0.3898
97 D A -0.1648
98 T A 0.3705
99 G A -0.1607
100 L A 0.0725
101 Y A 0.0000
102 I A 0.1092
103 C A 0.0000
104 K A 0.1453
105 V A 0.0000
106 E A 0.5664
107 L A 0.0000
108 M A 1.1078
109 Y A 1.3963
110 P A 0.6782
111 P A 0.5993
112 P A 0.7176
113 Y A 1.9569
114 Y A 1.8046
115 L A 1.3135
116 G A 0.0000
117 I A 1.3523
118 G A 0.0000
119 N A -0.9709
120 G A 0.0000
121 T A 0.0000
122 Q A 0.4948
123 I A 0.0000
124 Y A 1.4534
125 V A 0.0000
126 I A 0.4681
127 D A -2.0572
128 P A -1.8226
129 E A -2.1704
130 P A -1.4387
131 C A -0.5566
132 P A -1.3949
133 D A -2.3419
134 S A -1.8726
135 D A -2.4104
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018