Project name: 5F7-VHH2

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGITFSINTMGWYRQAPGKQRELVSLISSIGDTYYADSVRGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCKRFRTAAQGTDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -3.2486
• Maximal score value: 1.646
• Average score: -0.6269
• Total score value: -73.971

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.1757
2	V	A	-1.3460
3	Q	A	-1.2841
4	L	A	0.0000
5	V	A	1.0894
6	E	A	0.3409
7	S	A	-0.0932
8	G	A	-0.6995
9	G	A	0.1524
10	G	A	0.6998
11	L	A	1.4326
12	V	A	-0.0338
13	Q	A	-1.3013
14	P	A	-1.5687
15	G	A	-1.4111
16	G	A	-0.9991
17	S	A	-1.2658
18	L	A	-0.9053
19	R	A	-1.8956
20	L	A	0.0000
21	S	A	-0.3794
22	C	A	0.0000
23	A	A	-0.1438
24	A	A	0.0000
25	S	A	-1.0764
26	G	A	-1.3529
27	I	A	-0.4942
28	T	A	0.0018
29	F	A	0.0000
30	S	A	0.0492
31	I	A	1.3265
32	N	A	0.0000
33	T	A	0.0375
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	Y	A	-0.3079
38	R	A	0.0000
39	Q	A	-1.8423
40	A	A	-1.7312
41	P	A	-1.3782
42	G	A	-1.8715
43	K	A	-3.1990
44	Q	A	-3.2486
45	R	A	-3.0067
46	E	A	-2.2945
47	L	A	-0.2851
48	V	A	0.0000
49	S	A	0.0000
50	L	A	0.4885
51	I	A	0.0000
52	S	A	0.2279
53	S	A	0.6931
54	I	A	1.4933
55	G	A	-0.1657
56	D	A	-1.1602
57	T	A	-0.0989
58	Y	A	0.4600
59	Y	A	-0.2245
60	A	A	-1.0916
61	D	A	-2.3736
62	S	A	-1.7376
63	V	A	0.0000
64	R	A	-2.5760
65	G	A	-1.8238
66	R	A	-1.6143
67	F	A	0.0000
68	T	A	-0.7154
69	I	A	0.0000
70	S	A	-0.6141
71	R	A	-1.0964
72	D	A	-1.6577
73	N	A	-1.9255
74	S	A	-1.7852
75	K	A	-2.5024
76	N	A	-1.9285
77	T	A	-1.0778
78	L	A	0.0000
79	Y	A	-0.5456
80	L	A	0.0000
81	Q	A	-1.2690
82	M	A	0.0000
83	N	A	-1.4496
84	S	A	-1.2880
85	L	A	0.0000
86	R	A	-2.3037
87	A	A	-1.7044
88	E	A	-2.2420
89	D	A	0.0000
90	T	A	-0.4122
91	A	A	0.0000
92	V	A	0.4873
93	Y	A	0.0000
94	Y	A	0.0787
95	C	A	0.0000
96	K	A	0.0000
97	R	A	0.0000
98	F	A	-0.7405
99	R	A	-2.0658
100	T	A	-0.9466
101	A	A	-0.5571
102	A	A	-0.3593
103	Q	A	-0.8488
104	G	A	-1.2281
105	T	A	-1.1102
106	D	A	-0.9874
107	Y	A	-0.0840
108	W	A	0.3379
109	G	A	-0.0728
110	Q	A	-0.8958
111	G	A	0.0582
112	T	A	0.5518
113	L	A	1.6460
114	V	A	0.0000
115	T	A	0.3627
116	V	A	0.0000
117	S	A	-0.6661
118	S	A	-0.4494