Project name: Arg103

Chain sequence(s)	H: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSSQMSWFRQAPGKEREFISAVTLVSRTHYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAMYYCVARAAWGTDYREQGYRGQGTQVTVSS
Selected Chain(s)	H
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:07)

• Minimal score value: -3.6368
• Maximal score value: 1.4769
• Average score: -0.8267
• Total score value: -100.0278

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	H	-2.0184
2	V	H	-1.2298
3	Q	H	-1.4200
4	L	H	0.0000
5	L	H	0.6909
6	E	H	-0.0132
7	S	H	-0.6190
8	G	H	-1.2055
9	G	H	-0.6952
11	G	H	0.2153
12	L	H	1.1133
13	V	H	-0.0404
14	Q	H	-1.4009
15	P	H	-1.7519
16	G	H	-1.4996
17	G	H	-1.0431
18	S	H	-1.3516
19	L	H	-0.9961
20	R	H	-2.1596
21	L	H	0.0000
22	S	H	-0.4494
23	C	H	0.0000
24	A	H	-0.1543
25	A	H	0.0000
26	S	H	-0.7353
27	G	H	-1.0253
28	F	H	-0.3743
29	T	H	-0.3127
30	F	H	0.0000
35	S	H	-0.1833
36	S	H	0.2311
37	S	H	0.0000
38	Q	H	-0.0041
39	M	H	0.0000
40	S	H	0.0000
41	W	H	0.0000
42	F	H	-0.2719
43	R	H	0.0000
44	Q	H	-1.8734
45	A	H	-1.8514
46	P	H	-1.4453
47	G	H	-1.8116
48	K	H	-3.3440
49	E	H	-3.6368
50	R	H	-2.8818
51	E	H	-1.7310
52	F	H	-0.1785
53	I	H	0.0000
54	S	H	0.0000
55	A	H	0.0000
56	V	H	0.0000
57	T	H	0.0603
58	L	H	1.0464
59	V	H	1.4769
63	S	H	-0.1840
64	R	H	-1.4447
65	T	H	-0.9692
66	H	H	-1.3151
67	Y	H	-0.9938
68	A	H	-1.3793
69	D	H	-2.6029
70	S	H	-1.8303
71	V	H	0.0000
72	K	H	-2.7579
74	G	H	-1.8362
75	R	H	-1.8335
76	F	H	0.0000
77	T	H	-1.0203
78	I	H	0.0000
79	S	H	-0.7039
80	R	H	-0.9610
81	D	H	-1.6405
82	N	H	-1.9180
83	A	H	-1.5690
84	K	H	-2.3925
85	N	H	-1.9165
86	T	H	-1.0772
87	L	H	0.0000
88	Y	H	-0.6029
89	L	H	0.0000
90	Q	H	-1.4158
91	M	H	0.0000
92	N	H	-1.6814
93	S	H	-1.4467
94	L	H	0.0000
95	K	H	-2.6910
96	P	H	-2.0575
97	E	H	-2.4542
98	D	H	0.0000
99	T	H	-0.8876
100	A	H	0.0000
101	M	H	-0.4007
102	Y	H	0.0000
103	Y	H	-0.4645
104	C	H	0.0000
105	V	H	-0.5756
106	A	H	0.0000
107	R	H	0.0000
108	A	H	-0.5027
109	A	H	-0.5934
110	W	H	-0.6728
111	G	H	-0.8026
111A	T	H	-1.0037
112A	D	H	-1.9783
112	Y	H	-1.1680
113	R	H	-2.3545
114	E	H	-1.7819
115	Q	H	-1.7036
116	G	H	-1.1471
117	Y	H	-0.6456
118	R	H	-1.7499
119	G	H	0.0000
120	Q	H	-1.3847
121	G	H	0.0000
122	T	H	-0.5532
123	Q	H	-0.5946
124	V	H	0.0000
125	T	H	-0.2515
126	V	H	0.0000
127	S	H	-0.7466
128	S	H	-0.4949