Project name: query_structure

Status: done

Started: 2026-03-16 23:04:35
Settings
Chain sequence(s) A: DVQLVESGGGSVQAGGSLRLSCAVSGSTYSPCTCGWYRQAPGKEREWVSSISSPGTIYYQDSVKGRFTISRDNAKNTCYLQMNSLQREDTGMYYCQIQCGVRSIREYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:05)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:05)
Show buried residues

Minimal score value
-3.2892
Maximal score value
1.547
Average score
-0.7412
Total score value
-87.464

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 D A -2.1026
2 V A -1.3835
3 Q A -1.1242
4 L A 0.0000
5 V A 0.9024
6 E A 0.0000
7 S A -0.5092
8 G A -1.2538
9 G A -1.1779
10 G A -0.9186
11 S A -0.6972
12 V A -0.8738
13 Q A -1.7492
14 A A -1.8550
15 G A -1.4130
16 G A -0.9792
17 S A -1.1607
18 L A -1.1653
19 R A -2.1492
20 L A 0.0000
21 S A -0.4111
22 C A 0.0000
23 A A -0.2264
24 V A -0.3322
25 S A -0.9298
26 G A -1.1498
27 S A -0.5349
28 T A -0.1171
29 Y A 1.1124
30 S A 0.6993
31 P A 0.1915
32 C A 0.0000
33 T A -0.4046
34 C A 0.0000
35 G A 0.0000
36 W A 0.0000
37 Y A -0.1308
38 R A 0.0000
39 Q A -1.8127
40 A A -1.7958
41 P A -1.4449
42 G A -1.6956
43 K A -2.7073
44 E A -3.1053
45 R A -2.2911
46 E A -1.2318
47 W A -0.0149
48 V A 0.0000
49 S A 0.0000
50 S A 0.0000
51 I A 0.0000
52 S A 0.0056
53 S A -0.5024
54 P A -0.3593
55 G A -0.1221
56 T A 0.5040
57 I A 1.5470
58 Y A 1.3960
59 Y A -0.1088
60 Q A -1.2392
61 D A -2.4404
62 S A -1.9177
63 V A 0.0000
64 K A -2.5266
65 G A -1.8003
66 R A -1.4225
67 F A 0.0000
68 T A -0.5914
69 I A 0.0000
70 S A -0.4899
71 R A -1.4021
72 D A -2.1086
73 N A -2.4150
74 A A -1.7827
75 K A -2.5627
76 N A -2.0842
77 T A 0.0000
78 C A 0.0000
79 Y A -0.6809
80 L A 0.0000
81 Q A -1.2792
82 M A 0.0000
83 N A -1.3181
84 S A -1.0736
85 L A 0.0000
86 Q A -2.5772
87 R A -3.2892
88 E A -2.9772
89 D A 0.0000
90 T A -1.5513
91 G A 0.0000
92 M A -0.6342
93 Y A 0.0000
94 Y A -0.1253
95 C A 0.0000
96 Q A 0.0000
97 I A 0.0000
98 Q A -0.8034
99 C A 0.0000
100 G A 0.3220
101 V A 0.9693
102 R A -0.8454
103 S A -0.3289
104 I A 0.4825
105 R A -1.7931
106 E A -1.9130
107 Y A -0.8015
108 W A -0.0672
109 G A -0.1121
110 Q A -0.8843
111 G A 0.0000
112 T A -0.7566
113 Q A -1.3395
114 V A 0.0000
115 T A -1.1819
116 V A 0.0000
117 S A -1.4253
118 S A -1.1132
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018