Project name: c57f611504a66db [mutate: LV105H]

Status: done

Started: 2026-06-04 14:45:30
Settings
Chain sequence(s) H: EVQLLESGGGLVQPGGSLRLSCAMSGHFFNLYIMAWFRQAPGKEREFVAGVSTSGRTSLYADSVKGRFTISRDNSKTTGYLQMNSLKSEDTAVYYCAARSSASELWVPSGDEYYAWWGQGTTVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues LV105H
Energy difference between WT (input) and mutated protein (by FoldX) 0.444293 kcal/mol
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:28)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:54)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:55)
Show buried residues

Minimal score value
-3.7361
Maximal score value
1.6628
Average score
-0.688
Total score value
-87.3799

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E H -2.3343
2 V H 0.0000
3 Q H -1.3923
4 L H 0.0000
5 L H 0.8653
6 E H -0.0055
7 S H -0.4594
8 G H -1.0872
9 G H -0.4952
10 G H 0.2269
11 L H 1.1259
12 V H 0.0000
13 Q H -1.4659
14 P H -1.7294
15 G H -1.4683
16 G H -0.9786
17 S H -1.2719
18 L H -0.9337
19 R H -2.1334
20 L H 0.0000
21 S H -0.4624
22 C H 0.0000
23 A H -0.0996
24 M H 0.0000
25 S H -0.8043
26 G H -1.3056
27 H H -0.7024
28 F H 0.8831
29 F H 0.0000
30 N H -0.6009
31 L H 0.7353
32 Y H 0.5058
33 I H 0.0000
34 M H 0.0000
35 A H 0.0000
36 W H 0.0000
37 F H 0.0000
38 R H -1.5658
39 Q H -2.2219
40 A H -1.9715
41 P H -1.4197
42 G H -1.9722
43 K H -3.4680
44 E H -3.7361
45 R H -3.2352
46 E H -3.2014
47 F H 0.0000
48 V H 0.0000
49 A H 0.0000
50 G H 0.0000
51 V H 0.0000
52 S H 0.0000
53 T H -0.4111
54 S H -0.8977
55 G H -1.7023
56 R H -1.9224
57 T H -0.5911
58 S H -0.2891
59 L H 0.1380
60 Y H -0.7315
61 A H -1.5419
62 D H -2.4955
63 S H -1.8511
64 V H 0.0000
65 K H -2.6142
66 G H -1.8032
67 R H -1.5571
68 F H 0.0000
69 T H -0.8256
70 I H 0.0000
71 S H -0.7957
72 R H -1.4619
73 D H -1.9447
74 N H -2.1559
75 S H -1.9375
76 K H -2.3695
77 T H -1.6905
78 T H 0.0000
79 G H 0.0000
80 Y H -0.6473
81 L H 0.0000
82 Q H -1.2565
83 M H 0.0000
84 N H -1.4023
85 S H -1.2691
86 L H 0.0000
87 K H -2.4851
88 S H -2.0143
89 E H -2.3187
90 D H 0.0000
91 T H -0.7810
92 A H 0.0000
93 V H -0.0390
94 Y H 0.0000
95 Y H -0.2873
96 C H 0.0000
97 A H 0.0000
98 A H 0.0000
99 R H -0.0334
100 S H 0.2092
101 S H 0.3344
102 A H 0.1954
103 S H 0.0070
104 E H 0.4535
105 V H 1.6628 mutated: LV105H
106 W H 1.5416
107 V H 0.0000
108 P H 0.0000
109 S H -0.5905
110 G H -1.3024
111 D H -1.9951
112 E H -1.9180
113 Y H -0.4249
114 Y H 0.0000
115 A H -0.0597
116 W H 0.1171
117 W H 0.0244
118 G H -0.2762
119 Q H -0.9699
120 G H -0.4201
121 T H -0.2710
122 T H 0.0682
123 V H 0.0000
124 T H -0.1022
125 V H 0.0000
126 S H -0.5654
127 S H -0.9328
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018