Project name: Mb5-11_LFLFLL

Status: done

Started: 2026-07-06 06:29:30
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRFTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSLNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:08)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:09)
Show buried residues

Minimal score value
-2.7718
Maximal score value
1.3637
Average score
-0.7468
Total score value
-81.4027

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3441
2 Q A -0.8527
3 A A -0.7162
4 N A -1.1577
5 S A -0.9882
6 G A -1.2621
7 S A -1.2004
8 L A 0.0000
9 E A -1.8364
10 V A -0.5090
11 V A 0.4072
12 E A -1.2491
13 A A -0.7833
14 S A -1.0340
15 P A -1.5040
16 T A -1.1137
17 S A -1.0265
18 L A 0.0000
19 Q A -0.7631
20 L A 0.0000
21 S A -1.0389
22 W A 0.0000
23 D A -2.2257
24 A A -1.3978
25 F A 0.0000
26 H A -1.4305
27 R A -0.3902
28 Y A 0.5134
29 H A -0.2153
30 N A -0.7785
31 G A -0.0602
32 F A 1.3637
33 T A 0.4586
34 H A -0.1992
35 P A -0.5299
36 V A -1.0266
37 R A -1.4264
38 Y A -0.8084
39 Y A 0.0000
40 R A -0.8185
41 F A 0.0000
42 T A -0.6661
43 Y A -0.4399
44 G A -0.9453
45 E A -1.8882
46 T A -1.5122
47 G A -1.4027
48 G A -1.5241
49 N A -1.5806
50 S A -1.0014
51 P A -0.4550
52 V A 0.2577
53 Q A -1.2705
54 E A -1.8836
55 F A -0.8232
56 T A -0.2368
57 V A -0.3963
58 P A -0.8977
59 G A -1.1721
60 S A -1.1552
61 K A -1.5369
62 S A -1.1866
63 T A -0.7601
64 A A 0.0000
65 T A -0.3311
66 L A 0.0000
67 S A -0.7690
68 G A -1.0023
69 L A 0.0000
70 K A -2.4587
71 P A -1.9350
72 G A -1.2213
73 V A -1.5306
74 D A -2.7718
75 Y A 0.0000
76 T A -0.9126
77 F A 0.0000
78 T A -0.4641
79 V A 0.0000
80 Y A -0.2854
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4719
85 Y A 0.0000
86 P A -0.4760
87 R A -1.1138
88 Y A 0.7055
89 G A 0.7097
90 Y A 1.1196
91 G A 0.5254
92 E A -0.5685
93 S A 0.0000
94 G A -0.6032
95 P A -0.4879
96 L A -0.3748
97 S A -0.5862
98 L A -0.7591
99 N A -1.8315
100 Y A -1.4881
101 R A -2.0980
102 T A 0.0000
103 E A -1.5407
104 L A -1.0633
105 D A -2.6402
106 K A -2.7480
107 P A -1.8390
108 S A -1.6396
109 Q A -1.6627
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018