Project name: query_structure

Status: done

Started: 2026-03-16 22:48:51
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWYAPAVTVDFYYITYGETGGNSNIQAFKVPGYYSTATISGLSPGVDYTITVYASCNYRACSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:47)
Show buried residues

Minimal score value
-2.3082
Maximal score value
2.1271
Average score
-0.1557
Total score value
-14.1691

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7798
2 S A 0.7417
3 S A 0.6321
4 V A 0.5887
5 P A 0.0000
6 T A -0.4088
7 K A -1.4749
8 L A 0.0000
9 E A -1.3067
10 V A 0.2377
11 V A 1.6007
12 A A 0.9287
13 A A 0.3358
14 T A -0.3815
15 P A -0.8113
16 T A -0.5402
17 S A -0.3261
18 L A 0.0000
19 L A 0.7853
20 I A 0.0000
21 S A 0.1281
22 W A 0.0000
23 Y A 0.8110
24 A A 0.9814
25 P A 0.8154
26 A A 0.8083
27 V A 0.7164
28 T A 0.0835
29 V A 0.0000
30 D A -0.8133
31 F A 0.2548
32 Y A 0.0000
33 Y A 0.0758
34 I A 0.0000
35 T A 0.3187
36 Y A 0.1714
37 G A 0.0000
38 E A -1.3212
39 T A -1.1687
40 G A -1.2038
41 G A -1.4784
42 N A -1.6935
43 S A -1.1855
44 N A -0.9194
45 I A 0.7466
46 Q A 0.1040
47 A A 0.0676
48 F A -0.2272
49 K A -1.2090
50 V A 0.0000
51 P A 0.4295
52 G A 0.7997
53 Y A 1.8411
54 Y A 2.1271
55 S A 1.2366
56 T A 0.7651
57 A A 0.0000
58 T A 0.2369
59 I A 0.0000
60 S A -0.4806
61 G A -0.6915
62 L A 0.0000
63 S A -0.8301
64 P A -0.9864
65 G A -1.0654
66 V A -0.8630
67 D A -1.8018
68 Y A 0.0000
69 T A -0.6340
70 I A 0.0000
71 T A 0.1970
72 V A 0.0000
73 Y A 0.3194
74 A A 0.0000
75 S A 0.0000
76 C A -0.6947
77 N A -1.3113
78 Y A -0.1993
79 R A -1.5141
80 A A -0.5801
81 C A -0.2041
82 S A 0.0000
83 S A -0.0610
84 P A 0.0145
85 I A 0.0541
86 S A -0.3336
87 I A -0.6381
88 N A -1.6770
89 Y A -1.3847
90 R A -2.3082
91 T A -1.1751
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018