Project name: NATIVE_BETA_LACTO

Status: done

Started: 2024-06-11 10:57:02
Settings
Chain sequence(s) A: LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:16)
Show buried residues

Minimal score value
-4.364
Maximal score value
1.6179
Average score
-1.1586
Total score value
-187.6893

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 L A 1.6179
2 I A 0.5914
3 V A 0.0000
4 T A 0.1531
5 Q A -0.5651
6 T A -0.6257
7 M A -1.2062
8 K A -2.0993
9 G A -1.4957
10 L A 0.0000
11 D A -2.2521
12 I A -1.8575
13 Q A -2.4964
14 K A -2.8712
15 V A 0.0000
16 A A -1.4682
17 G A -1.0068
18 T A -0.6489
19 W A 0.0000
20 Y A -0.6289
21 S A 0.0000
22 L A 0.0000
23 A A 0.0000
24 M A 0.0000
25 A A 0.0000
26 A A 0.0000
27 S A 0.0000
28 D A -0.8472
29 I A 0.3099
30 S A -0.2326
31 L A 0.0000
32 L A 0.0000
33 D A -1.8632
34 A A -1.3139
35 Q A -1.4368
36 S A -1.8288
37 A A 0.0000
38 P A -0.8230
39 L A -0.3758
40 R A -0.7380
41 V A 0.0000
42 Y A 0.0000
43 V A 0.0000
44 E A -1.2668
45 E A -1.2963
46 L A 0.0000
47 K A -1.7409
48 P A -1.9567
49 T A -1.6561
50 P A -1.5436
51 E A -2.4989
52 G A -2.4079
53 D A -2.4411
54 L A 0.0000
55 E A -1.1371
56 I A 0.0000
57 L A -1.3657
58 L A 0.0000
59 Q A 0.0000
60 K A -1.7342
61 W A -2.3315
62 E A -3.3797
63 N A -3.0462
64 G A -2.4695
65 E A -3.0334
66 C A -1.9838
67 A A -2.1039
68 Q A -2.2086
69 K A -2.1535
70 K A -2.1102
71 I A -0.7479
72 I A -0.6222
73 A A 0.0000
74 E A -3.1982
75 K A -3.0915
76 T A -2.0844
77 K A -1.7343
78 I A -0.7124
79 P A -1.1615
80 A A 0.0000
81 V A 0.0000
82 F A 0.0000
83 K A -2.6526
84 I A -1.9582
85 D A -2.4394
86 A A -1.4026
87 L A 0.2259
88 N A -1.7011
89 E A -2.7526
90 N A -2.1516
91 K A -1.5779
92 V A 0.0000
93 L A 0.0000
94 V A 0.0000
95 L A 0.0000
96 D A -0.9365
97 T A 0.0000
98 D A -1.3021
99 Y A -1.7505
100 K A -2.3367
101 K A -1.8943
102 Y A 0.0000
103 L A 0.0000
104 L A 0.0000
105 F A 0.0000
106 C A 0.0000
107 M A 0.0085
108 E A 0.0000
109 N A -1.6287
110 S A -1.4484
111 A A -1.8469
112 E A -2.8985
113 P A -1.9222
114 E A -2.9328
115 Q A -2.7635
116 S A -1.6615
117 L A 0.0000
118 A A 0.0000
119 C A 0.0000
120 Q A 0.0000
121 C A 0.0000
122 L A 0.0000
123 V A 0.0000
124 R A -1.2276
125 T A -1.1631
126 P A -1.4991
127 E A -2.1329
128 V A -1.0572
129 D A -2.0398
130 D A -3.3135
131 E A -3.6567
132 A A 0.0000
133 L A -2.7503
134 E A -4.3640
135 K A -3.6084
136 F A 0.0000
137 D A -4.2468
138 K A -3.7639
139 A A 0.0000
140 L A 0.0000
141 K A -2.6332
142 A A -1.2652
143 L A -1.0363
144 P A -1.0554
145 M A 0.0000
146 H A -0.9609
147 I A -0.9341
148 R A -2.0564
149 L A -0.9327
150 S A -0.6785
151 F A 0.0000
152 N A -1.8424
153 P A -1.8507
154 T A -1.6006
155 Q A -1.5809
156 L A 0.0000
157 E A -3.1829
158 E A -2.7998
159 Q A -2.1912
160 C A 0.0000
161 H A 0.0000
162 I A 0.6864
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018