Project name: a7b0946f3c29050

Status: done

Started: 2026-05-15 06:00:20
Settings
Chain sequence(s) A: ATVHQKTRKEKNCPDGYIYSSNTASGYDCGVWICRRVGSAFCSRTGDYTSPSEFDIYEFYVEGW
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)
Show buried residues

Minimal score value
-3.501
Maximal score value
1.9727
Average score
-0.4706
Total score value
-30.1204

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A 0.5907
2 T A 0.3311
3 V A 1.0868
4 H A -0.1176
5 Q A -0.7118
6 K A -1.5315
7 T A -1.6637
8 R A -2.6507
9 K A -3.5010
10 E A -3.4604
11 K A -3.1857
12 N A -2.3583
13 C A -1.0234
14 P A -1.4877
15 D A -1.7980
16 G A -0.6781
17 Y A -0.2266
18 I A 0.7577
19 Y A 1.2272
20 S A 0.0000
21 S A -0.0263
22 N A -1.1282
23 T A -0.9915
24 A A -0.5934
25 S A -0.5024
26 G A -0.7111
27 Y A -0.8686
28 D A -1.6436
29 C A -0.1563
30 G A 0.4579
31 V A 1.9459
32 W A 1.9727
33 I A 1.4689
34 C A 0.0000
35 R A 0.2891
36 R A -0.5619
37 V A 0.9578
38 G A 0.1648
39 S A -0.0315
40 A A 0.1450
41 F A 0.8542
42 C A 0.0000
43 S A -0.7856
44 R A -1.7477
45 T A -1.0172
46 G A -1.0402
47 D A -1.2021
48 Y A -0.1179
49 T A 0.0740
50 S A -0.1379
51 P A 0.0000
52 S A -1.6965
53 E A -3.1065
54 F A -1.8301
55 D A -1.9129
56 I A -0.5667
57 Y A 0.3015
58 E A -0.3519
59 F A 1.5430
60 Y A 1.2355
61 V A 1.0508
62 E A -0.5748
63 G A 0.0775
64 W A 1.0448
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018