Project name: PKN1 (cryptic)

Status: done

Started: 2026-07-03 10:44:08
Settings
Chain sequence(s) A: MASDAVQSEPRSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLRRATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTCSATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQTGPVSDGVWIKESGWKCGCLQVTVRQCHCACPLDEA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:04:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:04:01)
Show buried residues

Minimal score value
-5.2759
Maximal score value
2.5933
Average score
-0.9833
Total score value
-203.5499

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.8302
2 A A -0.0149
3 S A -0.5459
4 D A -1.4557
5 A A -0.4329
6 V A 0.3910
7 Q A -1.2480
8 S A -1.4745
9 E A -2.6665
10 P A -2.0987
11 R A -2.2695
12 S A -0.9944
13 W A 0.0876
14 S A -0.3627
15 L A -0.3390
16 L A -0.4036
17 E A -0.8342
18 Q A -1.0607
19 L A -0.5767
20 G A -0.8150
21 L A -0.6081
22 A A -0.6903
23 G A -0.8592
24 A A -0.8757
25 D A -1.7737
26 L A -0.3123
27 A A -0.3827
28 A A -1.0025
29 P A -1.1406
30 G A -1.4826
31 V A -1.2049
32 Q A -1.6554
33 Q A -2.0661
34 Q A -1.4517
35 L A 0.0000
36 E A -2.3380
37 L A -1.1635
38 E A 0.0000
39 R A -2.9828
40 E A -3.4877
41 R A -3.6507
42 L A 0.0000
43 R A -4.8462
44 R A -5.2759
45 E A -4.9464
46 I A 0.0000
47 R A -4.4126
48 K A -4.2623
49 E A 0.0000
50 L A -2.6363
51 K A -3.4052
52 L A -1.9560
53 K A -2.4535
54 E A -3.4252
55 G A -2.5148
56 A A 0.0000
57 E A -3.5143
58 N A -3.0246
59 L A -1.8248
60 R A -2.9848
61 R A -3.0470
62 A A -1.8488
63 T A 0.0000
64 T A -1.9020
65 D A -2.0237
66 L A -0.4812
67 G A -1.1752
68 R A -2.0490
69 S A -1.2612
70 L A -1.0136
71 G A -0.5201
72 P A -0.2272
73 V A 0.0000
74 E A -1.1027
75 L A 0.5978
76 L A 0.1662
77 L A -1.4265
78 R A -2.2422
79 G A -1.9304
80 S A 0.0000
81 S A -2.3017
82 R A -3.6955
83 R A -3.5968
84 L A 0.0000
85 D A -3.1620
86 L A -2.0785
87 L A 0.0000
88 H A -2.8839
89 Q A -2.4625
90 Q A -1.5795
91 L A 0.0000
92 Q A -2.2546
93 E A -1.5262
94 L A 0.0000
95 H A -0.9825
96 A A -0.1330
97 H A 0.6483
98 V A 1.8658
99 V A 2.5933
100 L A 2.0692
101 P A -0.0154
102 D A -1.3537
103 P A -0.9382
104 A A -0.8588
105 A A -0.8253
106 T A -0.9986
107 H A -1.9826
108 D A -2.5801
109 G A -1.9523
110 P A -1.5419
111 Q A -1.5886
112 S A -1.1081
113 P A -0.8723
114 G A -0.7025
115 A A -0.5634
116 G A -0.8087
117 G A -0.7293
118 P A -0.3788
119 T A -0.1620
120 C A 0.4688
121 S A -0.0123
122 A A 0.1211
123 T A -0.3475
124 N A -0.5200
125 L A 0.7502
126 S A -0.6201
127 R A -1.7789
128 V A -0.5565
129 A A -0.9264
130 G A -1.3975
131 L A -0.5000
132 E A -2.1465
133 K A -2.2842
134 Q A -1.3176
135 L A 0.0142
136 A A -0.6203
137 I A -0.4805
138 E A -1.3592
139 L A -0.5351
140 K A -1.6298
141 V A -0.5474
142 K A -2.4845
143 Q A -2.6508
144 G A -1.7490
145 A A -1.3456
146 E A -2.6203
147 N A -1.8490
148 M A -0.0007
149 I A 0.3103
150 Q A -1.2895
151 T A -0.6458
152 Y A -0.5510
153 S A -0.9387
154 N A -1.7009
155 G A -1.4874
156 S A -1.6885
157 T A -2.0027
158 K A -2.6509
159 D A -1.8605
160 R A -2.4433
161 K A -1.8674
162 L A 0.1072
163 L A 0.3378
164 L A 0.6621
165 T A 0.2952
166 A A 0.3274
167 Q A -0.3473
168 Q A -0.5618
169 M A 0.4991
170 L A 0.6598
171 Q A -1.0438
172 T A -0.3523
173 G A -0.1803
174 P A 0.3056
175 V A 1.0089
176 S A -0.2312
177 D A -1.0507
178 G A 0.2720
179 V A 2.1236
180 W A 2.2349
181 I A 1.5529
182 K A -1.2761
183 E A -2.0131
184 S A -1.3319
185 G A -1.0058
186 W A -0.0050
187 K A -0.9250
188 C A 0.2917
189 G A 0.3081
190 C A 1.2757
191 L A 1.7187
192 Q A 0.8032
193 V A 1.9052
194 T A 0.8547
195 V A 1.0088
196 R A -1.2337
197 Q A -1.2743
198 C A -0.0910
199 H A -0.6826
200 C A 0.4808
201 A A 0.5559
202 C A 0.8726
203 P A 0.3379
204 L A 0.2762
205 D A -1.8669
206 E A -2.3415
207 A A -1.2469
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018