Project name: ug4

Status: done

Started: 2026-05-21 08:34:05
Settings
Chain sequence(s) A: PLGLRNFCFAGDDRGHTRDIADRLAAAAPELTVHRVPYSLGPDAYLQAIRDAAAAGADVVVLGGSWPSVYDEARAALDGGAKRVIGIAGPDRIEDPATRAAVDRVKRELPEFSLQFFAEEGAARDRDIDAFVAQLLAWAGRS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:07)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:07)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:07)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:07)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:07)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:07)
Show buried residues

Minimal score value
-4.0578
Maximal score value
0.8348
Average score
-1.0691
Total score value
-151.8147

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 P A -0.1862
2 L A 0.8348
3 G A -0.3227
4 L A 0.0000
5 R A -2.0985
6 N A -1.3977
7 F A 0.0000
8 C A 0.0000
9 F A 0.0000
10 A A 0.0000
11 G A -0.6504
12 D A 0.0000
13 D A -2.1910
14 R A -2.7059
15 G A -2.0465
16 H A -1.6795
17 T A 0.0000
18 R A -2.7228
19 D A -2.3725
20 I A 0.0000
21 A A 0.0000
22 D A -2.2125
23 R A -2.6551
24 L A 0.0000
25 A A -1.2116
26 A A -1.1025
27 A A -0.9928
28 A A 0.0000
29 P A -1.3061
30 E A -2.0556
31 L A -1.3789
32 T A -0.7868
33 V A -0.7471
34 H A -0.9158
35 R A -1.4340
36 V A 0.0000
37 P A -0.2565
38 Y A 0.7724
39 S A 0.5029
40 L A 0.4622
41 G A -0.3017
42 P A -0.9027
43 D A -1.8773
44 A A -0.9539
45 Y A -0.3911
46 L A -1.1569
47 Q A -1.5719
48 A A -1.3397
49 I A 0.0000
50 R A -2.0205
51 D A -2.0745
52 A A 0.0000
53 A A 0.0000
54 A A -1.1164
55 A A -0.7187
56 G A -0.7987
57 A A 0.0000
58 D A -1.4529
59 V A 0.0000
60 V A 0.0000
61 V A 0.0000
62 L A 0.0000
63 G A 0.0262
64 G A 0.0000
65 S A -0.7821
66 W A 0.5180
67 P A -0.2508
68 S A -0.3434
69 V A 0.0000
70 Y A -1.4490
71 D A -1.9651
72 E A 0.0000
73 A A 0.0000
74 R A -1.9781
75 A A 0.0000
76 A A 0.0000
77 L A -2.0203
78 D A -2.4960
79 G A -2.0442
80 G A -1.7652
81 A A -1.8214
82 K A -2.2076
83 R A -1.9736
84 V A 0.0000
85 I A 0.0000
86 G A 0.0000
87 I A 0.0000
88 A A 0.0000
89 G A 0.0000
90 P A -1.6661
91 D A -3.4819
92 R A -3.2038
93 I A 0.0000
94 E A -4.0578
95 D A -3.4604
96 P A -1.8815
97 A A -1.0216
98 T A 0.0000
99 R A -2.5801
100 A A -1.6767
101 A A 0.0000
102 V A 0.0000
103 D A -2.7114
104 R A -3.5676
105 V A 0.0000
106 K A -3.8427
107 R A -3.9916
108 E A -3.3319
109 L A 0.0000
110 P A -2.0710
111 E A -2.1993
112 F A 0.0000
113 S A -0.9155
114 L A -0.0618
115 Q A -0.0401
116 F A 0.1236
117 F A 0.0000
118 A A -1.7977
119 E A -2.6247
120 E A -3.0740
121 G A -2.2934
122 A A -1.9085
123 A A -2.2864
124 R A -3.0802
125 D A -3.5789
126 R A -3.1308
127 D A -2.0441
128 I A 0.0000
129 D A -2.3644
130 A A -1.4190
131 F A 0.0000
132 V A 0.0000
133 A A -0.9068
134 Q A -1.0703
135 L A 0.0000
136 L A 0.0000
137 A A -0.7522
138 W A -0.3647
139 A A 0.0000
140 G A -1.1443
141 R A -1.4471
142 S A -0.8018
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018