Project name: gal10_6H

Chain sequence(s)	A: MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKRGGGGSHHHHHH
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:22)

• Minimal score value: -3.6013
• Maximal score value: 1.5938
• Average score: -0.8111
• Total score value: -124.0969

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.1795
2	S	A	0.9126
3	L	A	1.5748
4	L	A	0.7964
5	P	A	0.5215
6	V	A	0.3086
7	P	A	-0.1850
8	Y	A	-0.0154
9	T	A	-0.0519
10	E	A	-0.6155
11	A	A	-0.5627
12	A	A	0.0000
13	S	A	-0.6489
14	L	A	0.0000
15	S	A	-0.1568
16	T	A	-0.6060
17	G	A	0.2067
18	S	A	0.0000
19	T	A	0.3840
20	V	A	0.0000
21	T	A	-0.8597
22	I	A	0.0000
23	K	A	-2.2261
24	G	A	0.0000
25	R	A	-2.7689
26	P	A	0.0000
27	L	A	0.5732
28	A	A	0.8396
29	C	A	1.5938
30	F	A	1.5398
31	L	A	1.2499
32	N	A	-0.6613
33	E	A	-1.3522
34	P	A	0.0000
35	Y	A	0.0000
36	L	A	0.0000
37	Q	A	-0.5700
38	V	A	0.0000
39	D	A	0.0000
40	F	A	0.0000
41	H	A	0.0000
42	T	A	-1.6025
43	E	A	-2.3457
44	M	A	-1.3717
45	K	A	-2.8179
46	E	A	-3.3951
47	E	A	-3.2756
48	S	A	0.0000
49	D	A	-1.2705
50	I	A	0.0000
51	V	A	0.0000
52	F	A	0.0000
53	H	A	0.0000
54	F	A	0.0000
55	Q	A	-0.5789
56	V	A	0.0000
57	C	A	0.0000
58	F	A	0.0000
59	G	A	-1.9791
60	R	A	-2.9224
61	R	A	-2.9734
62	V	A	0.0000
63	V	A	0.0000
64	M	A	0.0000
65	N	A	0.0000
66	S	A	0.0000
67	R	A	-0.4881
68	E	A	-0.3374
69	Y	A	0.5887
70	G	A	-0.3696
71	A	A	0.2334
72	W	A	0.2990
73	K	A	-0.9685
74	Q	A	-1.6668
75	Q	A	-1.5096
76	V	A	-0.9531
77	E	A	-2.5654
78	S	A	-2.3560
79	K	A	-3.3582
80	N	A	-2.6004
81	M	A	-1.7859
82	P	A	-1.2443
83	F	A	0.0000
84	Q	A	-2.4149
85	D	A	-1.9557
86	G	A	-1.8489
87	Q	A	-3.0281
88	E	A	-3.6013
89	F	A	0.0000
90	E	A	-2.3971
91	L	A	0.0000
92	S	A	-0.8360
93	I	A	0.0000
94	S	A	-0.0796
95	V	A	0.0000
96	L	A	-0.9703
97	P	A	-1.6568
98	D	A	-3.1111
99	K	A	-2.8745
100	Y	A	0.0000
101	Q	A	-0.8351
102	V	A	0.0000
103	M	A	-0.9954
104	V	A	0.0000
105	N	A	-2.4085
106	G	A	-1.7951
107	Q	A	-1.9028
108	S	A	-1.0279
109	S	A	-0.7975
110	Y	A	-0.2848
111	T	A	-0.8827
112	F	A	0.0000
113	D	A	-2.9074
114	H	A	-2.5134
115	R	A	-1.8442
116	I	A	-1.6188
117	K	A	-2.3856
118	P	A	0.0000
119	E	A	-1.6163
120	A	A	-1.4850
121	V	A	0.0000
122	K	A	-1.7718
123	M	A	0.0000
124	V	A	0.0000
125	Q	A	-0.0934
126	V	A	0.0000
127	W	A	-0.4726
128	R	A	-1.0235
129	D	A	0.0000
130	I	A	0.0000
131	S	A	-0.6118
132	L	A	0.0000
133	T	A	-0.4392
134	K	A	-1.4742
135	F	A	0.0000
136	N	A	-1.4422
137	V	A	-0.1369
138	S	A	0.4242
139	Y	A	1.2905
140	L	A	0.7930
141	K	A	-1.6024
142	R	A	-2.2939
143	G	A	-1.9358
144	G	A	-1.8641
145	G	A	-1.4430
146	G	A	-1.3592
147	S	A	-1.4476
148	H	A	-2.1211
149	H	A	-2.4407
150	H	A	-2.6138
151	H	A	-2.5729
152	H	A	-2.3379
153	H	A	-1.8168