Project name: query_structure

Status: done

Started: 2026-03-17 00:44:55
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVVYYEMYWYRQAPGKEREWVAAITSSGWYTHYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDWGASWKQYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:41)
Show buried residues

Minimal score value
-3.862
Maximal score value
1.6662
Average score
-0.6998
Total score value
-83.9716

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4752
2 V A -0.8167
3 Q A -0.8931
4 L A 0.0000
5 V A 1.0026
6 E A 0.0000
7 S A -0.6158
8 G A -1.0732
9 G A -0.8268
10 G A -0.0651
11 L A 0.9316
12 V A 0.0000
13 Q A -1.3482
14 A A -1.5196
15 G A -1.4125
16 G A -0.9595
17 S A -1.2824
18 L A -0.9624
19 R A -2.1794
20 L A 0.0000
21 S A -0.4506
22 C A 0.0000
23 A A -0.1263
24 A A 0.0000
25 S A -0.7408
26 G A -1.0805
27 F A 0.0000
28 P A -0.1588
29 V A 0.0000
30 V A 0.7720
31 Y A 1.4187
32 Y A 0.7329
33 E A 0.2044
34 M A 0.0000
35 Y A 0.0359
36 W A 0.0000
37 Y A 0.0000
38 R A -1.6793
39 Q A -2.4678
40 A A -2.2145
41 P A -1.4426
42 G A -1.9778
43 K A -3.5457
44 E A -3.8620
45 R A -3.3003
46 E A -2.9379
47 W A -1.1667
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 T A 0.5095
53 S A 0.6609
54 S A 0.6866
55 G A 0.6318
56 W A 1.6662
57 Y A 1.5890
58 T A 0.4818
59 H A -0.7776
60 Y A -1.2235
61 A A -1.6744
62 D A -2.5404
63 S A -1.8099
64 V A 0.0000
65 K A -2.7486
66 G A -1.8057
67 R A -1.5440
68 F A 0.0000
69 T A -0.9845
70 I A 0.0000
71 S A -0.3060
72 R A -1.0853
73 D A -1.7521
74 N A -1.6837
75 A A -1.4953
76 K A -2.3687
77 N A -1.6220
78 T A 0.0000
79 V A 0.0000
80 Y A 0.0000
81 L A 0.0000
82 Q A -1.2862
83 M A 0.0000
84 N A -1.4769
85 S A -1.2825
86 L A 0.0000
87 K A -2.5536
88 P A -2.0192
89 E A -2.4155
90 D A 0.0000
91 T A -1.0109
92 A A 0.0000
93 V A -0.5281
94 Y A 0.0000
95 Y A -0.3117
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -1.2203
100 D A -0.6961
101 W A 0.4187
102 G A -0.2892
103 A A -0.1271
104 S A -0.0861
105 W A 0.0009
106 K A -1.9320
107 Q A -2.1553
108 Y A -1.3919
109 D A -2.1655
110 Y A -0.7685
111 W A -0.0838
112 G A -0.0539
113 Q A -0.8932
114 G A 0.0000
115 T A -0.6738
116 Q A -1.1249
117 V A 0.0000
118 T A -0.3473
119 V A 0.0000
120 S A -0.8184
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018