Project name: query_structure

Status: done

Started: 2026-03-16 23:17:25
Settings
Chain sequence(s) A: EVQLVESGGGSVQAGGSLRLSCAVSGYTYCSYDMSWYRQAPGKEREFVSGIDSDGSTSYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCAVDSVWRLCSLDPADFGYWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-3.1538
Maximal score value
1.1891
Average score
-0.7759
Total score value
-96.2061

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9977
2 V A -1.1155
3 Q A -1.2921
4 L A 0.0000
5 V A 0.3280
6 E A -0.3578
7 S A -0.7213
8 G A -1.2651
9 G A -1.2329
10 G A -0.9301
11 S A -0.7072
12 V A -0.7547
13 Q A -1.5937
14 A A -1.6285
15 G A -1.3435
16 G A -1.0822
17 S A -1.2463
18 L A -1.1771
19 R A -2.1630
20 L A 0.0000
21 S A -0.5565
22 C A 0.0000
23 A A -0.3192
24 V A 0.0000
25 S A -0.7392
26 G A -0.8651
27 Y A 0.5598
28 T A 0.5566
29 Y A 1.0860
30 C A 0.8318
31 S A -0.4885
32 Y A 0.0000
33 D A -1.3452
34 M A 0.0000
35 S A 0.0000
36 W A 0.0000
37 Y A 0.1971
38 R A 0.0000
39 Q A -1.8171
40 A A -1.8102
41 P A -1.2776
42 G A -1.7322
43 K A -2.8096
44 E A -3.1538
45 R A -2.3196
46 E A -1.0637
47 F A 0.3043
48 V A 0.0000
49 S A 0.0000
50 G A 0.0000
51 I A -1.1900
52 D A -2.1450
53 S A -1.6054
54 D A -2.5071
55 G A -1.9141
56 S A -1.3764
57 T A -0.7698
58 S A -0.5946
59 Y A -0.6964
60 A A -1.1174
61 D A -2.3539
62 S A -1.7112
63 V A 0.0000
64 K A -2.6284
65 G A -1.7754
66 R A -1.4955
67 F A 0.0000
68 T A -0.8813
69 I A 0.0000
70 S A -0.5657
71 Q A -1.3324
72 D A -1.7203
73 N A -1.8301
74 A A -1.3263
75 K A -2.1478
76 N A -1.2428
77 T A -1.0647
78 L A 0.0000
79 Y A -0.6145
80 L A 0.0000
81 Q A -1.2679
82 M A 0.0000
83 N A -1.4463
84 S A -1.2318
85 L A 0.0000
86 K A -2.2841
87 P A -1.8220
88 E A -2.2892
89 D A 0.0000
90 T A -1.1303
91 A A 0.0000
92 M A -0.6924
93 Y A 0.0000
94 Y A 0.0000
95 C A 0.0000
96 A A 0.0000
97 V A 0.0000
98 D A -0.8411
99 S A -0.3702
100 V A -0.0152
101 W A 0.6509
102 R A -0.8080
103 L A 1.1891
104 C A 0.6285
105 S A -0.2633
106 L A -0.6330
107 D A -2.1057
108 P A -0.9933
109 A A -0.6351
110 D A -0.7560
111 F A 0.9022
112 G A 0.3821
113 Y A 0.2577
114 W A 0.4691
115 G A -0.2382
116 Q A -1.1175
117 G A -0.7326
118 T A -0.9392
119 Q A -1.5193
120 V A 0.0000
121 T A -0.9467
122 V A 0.0000
123 S A -1.1189
124 S A -0.8393
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018