Project name: 73_rank

Status: done

Started: 2026-05-18 11:35:47
Settings
Chain sequence(s) B: SAEHKLEYVKETYHKWENGEDPSVDIFSPHFWYMFSTAYTEITGKPYHYTHFSIEKVRELTS
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-3.2311
Maximal score value
1.5161
Average score
-1.136
Total score value
-70.4323

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -1.3949
2 A B 0.0000
3 E B -2.8644
4 H B -2.6382
5 K B -1.8240
6 L B -2.2317
7 E B -3.2311
8 Y B -1.8858
9 V B 0.0000
10 K B -2.8634
11 E B -2.9332
12 T B -1.9790
13 Y B 0.0000
14 H B -2.6899
15 K B -3.1170
16 W B -2.2433
17 E B -2.0867
18 N B -2.7454
19 G B -2.5567
20 E B -3.1464
21 D B -2.4437
22 P B -1.6882
23 S B -1.1966
24 V B -1.2165
25 D B -1.3685
26 I B 0.0000
27 F B 1.4707
28 S B 0.1380
29 P B -0.0001
30 H B -0.4450
31 F B 0.0000
32 W B 0.0000
33 Y B 0.9314
34 M B 0.4459
35 F B 0.0000
36 S B -0.2412
37 T B -0.3206
38 A B 0.0000
39 Y B 0.0000
40 T B -1.6272
41 E B -2.1266
42 I B -0.6674
43 T B -1.0453
44 G B -1.6538
45 K B -2.2562
46 P B -1.4957
47 Y B 0.0000
48 H B -0.6359
49 Y B 0.6730
50 T B 0.2556
51 H B 0.0192
52 F B 1.5161
53 S B 0.0597
54 I B -0.8345
55 E B -2.6447
56 K B -2.2934
57 V B 0.0000
58 R B -3.2030
59 E B -2.8954
60 L B 0.0000
61 T B 0.0000
62 S B -1.2113
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018