Project name: a93bac51a081ff9

Chain sequence(s)	A: NFMLTQPHSVSESPGKTVTISCTRSSGSIASSYVQWYQQRDRFSGSIDSSSNSASLTISGLKTEDEAEYYCQSYENSNLYVVFGGGGAAAAA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:21)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:22)

• Minimal score value: -3.9123
• Maximal score value: 3.7662
• Average score: -0.0754
• Total score value: -6.9349

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-0.1614
2	F	A	2.2048
3	M	A	2.3364
4	L	A	2.1384
5	T	A	0.3596
6	Q	A	-1.2470
7	P	A	-1.0832
8	H	A	-1.1067
9	S	A	-0.2233
10	V	A	0.7230
11	S	A	-0.8302
12	E	A	-1.8958
13	S	A	-1.6618
14	P	A	-1.4343
15	G	A	-1.7259
16	K	A	-1.8430
17	T	A	-0.1555
18	V	A	1.6615
19	T	A	1.5276
20	I	A	1.9431
21	S	A	0.9397
22	C	A	0.6858
23	T	A	-0.8439
24	R	A	-1.9515
25	S	A	-0.9155
26	S	A	-0.8440
27	G	A	-0.0601
28	S	A	0.6287
29	I	A	1.9256
30	A	A	0.9371
31	S	A	0.7440
32	S	A	0.9668
33	Y	A	2.0282
34	V	A	2.1440
35	Q	A	0.8206
36	W	A	1.4422
37	Y	A	0.9354
38	Q	A	-1.1917
39	Q	A	-2.3795
40	R	A	-2.5844
61	D	A	-2.5084
62	R	A	-2.1114
63	F	A	0.1655
64	S	A	-0.2400
65	G	A	-0.1526
66	S	A	-0.0703
67	I	A	1.1437
68	D	A	-1.0081
69	S	A	-0.7540
70	S	A	-1.0634
71	S	A	-0.7740
72	N	A	-1.5345
73	S	A	-0.9063
74	A	A	-0.0055
75	S	A	0.5344
76	L	A	1.9269
77	T	A	1.4342
78	I	A	2.2183
79	S	A	0.7521
80	G	A	0.2253
81	L	A	0.7365
82	K	A	-1.4827
83	T	A	-1.8115
84	E	A	-3.4657
85	D	A	-3.9123
86	E	A	-3.5517
87	A	A	-1.9331
88	E	A	-1.8018
89	Y	A	0.5322
90	Y	A	0.9580
91	C	A	0.7254
92	Q	A	-0.1322
93	S	A	-0.1475
94	Y	A	-0.5235
95	E	A	-2.1686
96	N	A	-2.0639
97	S	A	-1.2241
98	N	A	-0.4337
99	L	A	2.0731
100	Y	A	3.1825
101	V	A	3.7662
102	V	A	3.6181
103	F	A	2.7241
104	G	A	1.3093
105	G	A	-0.6707
106	G	A	-0.9095
107	G	A	-0.5409
108	A	A	-0.2099
109	A	A	-0.1121
110	A	A	0.0774
111	A	A	0.1336
112	A	A	0.0984