Project name: query_structure

Status: done

Started: 2026-03-16 21:26:19
Settings
Chain sequence(s) A: MKAILVFALIAISIISVNAGMMTGGSVEQDASQKEYSDKAWKAVKGINDQASNNGPYYYAPIKVTKASTQVVAGISTKLEVLVGESNCKKGELQAHEITSSNCQIKDGGSRALYQVTIWEKPWENFEQFTVEKIRDVTADEQF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:50)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:51)
Show buried residues

Minimal score value
-3.67
Maximal score value
4.1692
Average score
-0.5744
Total score value
-82.1325

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4749
2 K A -0.3849
3 A A 1.0394
4 I A 3.0914
5 L A 3.6768
6 V A 4.1692
7 F A 4.1534
8 A A 2.9623
9 L A 3.5914
10 I A 3.5643
11 A A 2.6436
12 I A 3.4396
13 S A 2.4495
14 I A 3.5583
15 I A 3.3993
16 S A 1.6646
17 V A 1.8112
18 N A -0.1812
19 A A 0.2621
20 G A 0.1893
21 M A 1.1654
22 M A 1.3392
23 T A 0.8053
24 G A 0.9896
25 G A 0.5074
26 S A -0.1373
27 V A -0.3176
28 E A -2.6946
29 Q A -2.6916
30 D A -3.1707
31 A A -2.8352
32 S A -2.2450
33 Q A -2.9575
34 K A -3.6700
35 E A -3.5636
36 Y A -3.1295
37 S A -2.5420
38 D A -3.2834
39 K A -2.0962
40 A A 0.0000
41 W A -1.2938
42 K A -1.7936
43 A A 0.0000
44 V A 0.0000
45 K A -2.0757
46 G A -1.7358
47 I A 0.0000
48 N A 0.0000
49 D A -2.8923
50 Q A -2.4545
51 A A -1.4433
52 S A -1.5647
53 N A 0.0000
54 N A -1.7014
55 G A -1.0396
56 P A -1.1594
57 Y A -1.3346
58 Y A 0.0000
59 Y A -0.3642
60 A A 0.0000
61 P A -0.2011
62 I A 0.3880
63 K A -0.5956
64 V A 0.0000
65 T A -1.0591
66 K A -2.7671
67 A A 0.0000
68 S A -1.9610
69 T A -0.2740
70 Q A 0.4644
71 V A 2.1471
72 V A 1.7796
73 A A 0.9591
74 G A 0.0000
75 I A 0.9783
76 S A 0.0000
77 T A 0.0000
78 K A -1.4274
79 L A 0.0000
80 E A -1.7007
81 V A 0.0000
82 L A 0.0000
83 V A 0.0000
84 G A 0.0000
85 E A -1.0399
86 S A 0.0000
87 N A -1.8944
88 C A 0.0000
89 K A -2.4480
90 K A -2.1776
91 G A -2.0260
92 E A -2.7875
93 L A -2.3348
94 Q A -2.9353
95 A A 0.0000
96 H A -2.7173
97 E A -2.9317
98 I A 0.0000
99 T A -1.2544
100 S A -0.6825
101 S A -0.8231
102 N A -1.2609
103 C A 0.0000
104 Q A -1.4386
105 I A -0.7901
106 K A -2.0237
107 D A -2.5055
108 G A -1.5883
109 G A -1.2927
110 S A -1.0689
111 R A -1.0221
112 A A 0.0000
113 L A 0.0000
114 Y A 0.0000
115 Q A -1.5645
116 V A 0.0000
117 T A -0.6790
118 I A 0.0000
119 W A -0.1804
120 E A -0.7971
121 K A -0.9201
122 P A -0.8737
123 W A -0.0982
124 E A -1.8646
125 N A -1.9337
126 F A -1.3748
127 E A -2.2385
128 Q A -1.1950
129 F A -0.5608
130 T A -0.5123
131 V A -1.2512
132 E A -2.4795
133 K A -2.2519
134 I A -0.8201
135 R A -1.8419
136 D A -2.2979
137 V A 0.0000
138 T A -1.5875
139 A A -1.7980
140 D A -2.3496
141 E A -1.7130
142 Q A -1.2505
143 F A 0.4198
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018