Project name: aab3cbf3497b2f3

Chain sequence(s)	A: GEKEDPSLQELQDLLESDVFEHSDGLGSGGGVGGGDLECDFEEIIRELLMDP
Selected Chain(s)	A
Distance of aggregation	5 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)

• Minimal score value: -2.3734
• Maximal score value: 2.01
• Average score: -0.4201
• Total score value: -21.8469

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	G	A	-0.8059
2	E	A	-2.2168
3	K	A	-2.3734
4	E	A	-2.3366
5	D	A	-1.4657
6	P	A	-0.4872
7	S	A	0.0188
8	L	A	1.3002
9	Q	A	-1.2004
10	E	A	-1.8359
11	L	A	0.5905
12	Q	A	-0.9778
13	D	A	-1.6661
14	L	A	1.4909
15	L	A	1.4484
16	E	A	-1.4215
17	S	A	-0.8262
18	D	A	-1.5126
19	V	A	1.8008
20	F	A	1.9312
21	E	A	-1.6540
22	H	A	-1.3620
23	S	A	-0.7186
24	D	A	-1.9137
25	G	A	-0.5158
26	L	A	1.3793
27	G	A	-0.2247
28	S	A	-0.3847
29	G	A	-0.5884
30	G	A	-0.6313
31	G	A	-0.2346
32	V	A	1.6055
33	G	A	-0.2287
34	G	A	-0.6327
35	G	A	-0.8650
36	D	A	-1.5972
37	L	A	0.9083
38	E	A	-1.4150
39	C	A	0.0839
40	D	A	-1.3896
41	F	A	0.8918
42	E	A	-1.5837
43	E	A	-1.8887
44	I	A	1.1541
45	I	A	1.7627
46	R	A	-1.7036
47	E	A	-1.8490
48	L	A	1.4933
49	L	A	2.0100
50	M	A	1.0083
51	D	A	-1.6454
52	P	A	-0.5724