Project name: aae308f6a74e748

Chain sequence(s)	A: EVQLLESGGGLVQPGGSLRLSCAASGFTFSSQAMSWVRQAPGKGIEWLSTISAEGGSTSYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDFKFLWAPTGGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:52)

• Minimal score value: -2.6287
• Maximal score value: 2.2987
• Average score: -0.6779
• Total score value: -79.9923

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-1.9828
2	V	A	-1.1620
3	Q	A	-1.0341
4	L	A	0.0000
5	L	A	0.8254
6	E	A	-0.1745
7	S	A	-0.7671
8	G	A	-1.2481
9	G	A	-0.8432
10	G	A	-0.0567
11	L	A	1.0193
12	V	A	-0.0655
13	Q	A	-1.3616
14	P	A	-1.6051
15	G	A	-1.3715
16	G	A	-0.9279
17	S	A	-1.3070
18	L	A	-0.9868
19	R	A	-2.2735
20	L	A	0.0000
21	S	A	-0.5246
22	C	A	0.0000
23	A	A	-0.1733
24	A	A	0.0000
25	S	A	-0.8939
26	G	A	-1.1059
27	F	A	-0.5509
28	T	A	-0.3071
29	F	A	0.0000
30	S	A	-1.3339
31	S	A	-0.8306
32	Q	A	-1.0817
33	A	A	-0.6593
34	M	A	0.0000
35	S	A	0.0000
36	W	A	0.0000
37	V	A	0.0000
38	R	A	0.0000
39	Q	A	-1.0210
40	A	A	-1.3918
41	P	A	-1.1213
42	G	A	-1.5241
43	K	A	-2.2765
44	G	A	-1.3353
45	I	A	0.2304
46	E	A	-0.2716
47	W	A	0.5637
48	L	A	0.0000
49	S	A	0.0000
50	T	A	0.0000
51	I	A	0.0000
52	S	A	-1.0503
53	A	A	-1.4125
54	E	A	-2.3773
55	G	A	-1.6160
56	G	A	-1.2568
57	S	A	-0.8798
58	T	A	-0.3490
59	S	A	-0.5678
60	Y	A	-0.9294
61	A	A	-1.3054
62	D	A	-2.4856
63	S	A	-1.6711
64	V	A	0.0000
65	K	A	-2.6287
66	G	A	-1.7492
67	R	A	-1.5553
68	F	A	0.0000
69	T	A	-0.9780
70	I	A	0.0000
71	S	A	-0.5136
72	R	A	-1.1997
73	D	A	-1.6921
74	N	A	-2.0048
75	S	A	-1.5951
76	K	A	-2.3809
77	N	A	-1.7371
78	T	A	-1.0082
79	L	A	0.0000
80	Y	A	-0.6494
81	L	A	0.0000
82	Q	A	-1.5666
83	M	A	0.0000
84	N	A	-1.4981
85	S	A	-1.2182
86	L	A	0.0000
87	R	A	-2.3187
88	A	A	-1.7391
89	E	A	-2.2510
90	D	A	0.0000
91	T	A	-0.8683
92	A	A	0.0000
93	V	A	-0.3305
94	Y	A	0.0000
95	Y	A	0.0000
96	C	A	0.0000
97	A	A	-0.3083
98	K	A	-0.9515
99	D	A	-0.7024
100	F	A	1.0432
101	K	A	-0.0236
102	F	A	1.4940
103	L	A	2.2987
104	W	A	1.8204
105	A	A	0.5433
106	P	A	0.0695
107	T	A	-0.2179
108	G	A	-0.6475
109	G	A	-0.5948
110	Q	A	-1.2172
111	G	A	-0.7736
112	T	A	-0.8283
113	Q	A	-1.1821
114	V	A	0.0000
115	T	A	-0.2945
116	V	A	0.0000
117	S	A	-0.6992
118	S	A	-0.5055