Project name: ac570d315c87c19

Chain sequence(s)	A: NFMLTQPHSVSESPGKTVIISCTGSSGSIATNYVQWYQQRPGSAPTLLIFEDRKRPSGVPDRFSGSIDSSSNSASLTISGLRAEDEADYYCQSYDSSNQVFGGGTKLTVL
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:41)

• Minimal score value: -2.8406
• Maximal score value: 1.3171
• Average score: -0.6754
• Total score value: -74.293

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	N	A	-1.2365
2	F	A	-0.0856
3	M	A	0.9006
4	L	A	0.0000
5	T	A	0.0700
6	Q	A	0.0000
7	P	A	-0.8912
8	H	A	-1.5359
9	S	A	-1.1762
10	V	A	-0.3632
11	S	A	-0.1629
12	E	A	-0.5335
13	S	A	-0.5859
14	P	A	-1.2033
15	G	A	-1.8172
16	K	A	-2.1311
17	T	A	-0.9290
18	V	A	0.0000
19	I	A	1.3171
20	I	A	0.0000
21	S	A	0.2658
22	C	A	0.0000
23	T	A	-0.2960
24	G	A	-0.1045
25	S	A	-0.2273
26	S	A	-0.5274
27	G	A	-0.8151
28	S	A	-0.8184
29	I	A	0.0000
30	A	A	-0.2540
31	T	A	-0.2655
32	N	A	-0.2360
33	Y	A	0.5313
34	V	A	0.0000
35	Q	A	-0.1716
36	W	A	0.0000
37	Y	A	0.2683
38	Q	A	0.0000
39	Q	A	-1.4358
40	R	A	-2.3752
41	P	A	-1.4016
42	G	A	-1.0152
43	S	A	-0.9245
44	A	A	-0.5123
45	P	A	-0.5641
46	T	A	-0.1315
47	L	A	0.3021
48	L	A	0.0000
49	I	A	0.0000
50	F	A	-0.8621
51	E	A	-1.2915
52	D	A	-1.4158
53	R	A	-2.7770
54	K	A	-2.8333
55	R	A	-2.2791
56	P	A	-0.9398
57	S	A	-0.9296
58	G	A	-0.8545
59	V	A	-0.7303
60	P	A	-1.2413
61	D	A	-2.1467
62	R	A	-1.1952
63	F	A	0.0000
64	S	A	-1.3309
65	G	A	-1.2119
66	S	A	-1.1890
67	I	A	-0.6657
68	D	A	-1.5406
69	S	A	-1.0897
70	S	A	-0.8954
71	S	A	-0.8845
72	N	A	-1.0070
73	S	A	-0.7802
74	A	A	0.0000
75	S	A	-0.2190
76	L	A	0.0000
77	T	A	0.3760
78	I	A	0.0000
79	S	A	-1.0451
80	G	A	-1.4503
81	L	A	0.0000
82	R	A	-2.7422
83	A	A	-1.8119
84	E	A	-2.8406
85	D	A	0.0000
86	E	A	-2.4614
87	A	A	0.0000
88	D	A	-1.6361
89	Y	A	0.0000
90	Y	A	0.2055
91	C	A	0.0000
92	Q	A	0.0000
93	S	A	0.0000
94	Y	A	-0.6273
95	D	A	-1.4345
96	S	A	-1.2532
97	S	A	-1.2311
98	N	A	-2.0342
99	Q	A	-1.4433
100	V	A	-0.0834
101	F	A	1.1502
102	G	A	0.6468
103	G	A	-0.3670
104	G	A	-0.6389
105	T	A	0.0000
106	K	A	-2.0370
107	L	A	0.0000
108	T	A	-0.7975
109	V	A	-0.4115
110	L	A	1.0574