Project name: obj1 [mutate: SC119C, VG118C, VH116C, TK117C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	TK117C,VH116C,SC119C,VG118C
Energy difference between WT (input) and mutated protein (by FoldX)	5.95791 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:26)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:48)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)

• Minimal score value: -3.3333
• Maximal score value: 1.5458
• Average score: -0.6854
• Total score value: -82.2529

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9165
3	Q	C	-1.2443
4	L	C	0.0000
5	V	C	0.5648
6	E	C	0.1591
7	S	C	-0.4748
8	G	C	-0.8874
9	G	C	-0.2738
10	G	C	0.5619
11	L	C	1.2002
12	V	C	-0.1017
13	Q	C	-1.2337
14	P	C	-1.4142
15	G	C	-1.4231
16	G	C	-0.9741
17	S	C	-1.2279
18	L	C	-0.9453
19	R	C	-2.1382
20	L	C	0.0000
21	S	C	-0.5418
22	C	C	0.0000
23	A	C	-0.2017
24	A	C	0.0000
25	S	C	-0.2017
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3597
40	A	C	-1.1188
41	P	C	-1.2890
42	G	C	-1.4347
43	K	C	-2.1380
44	G	C	-1.0643
45	L	C	0.3880
46	E	C	-0.4122
47	W	C	0.3302
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3564
61	A	C	-1.1425
62	D	C	-2.3460
63	S	C	-1.7184
64	V	C	0.0000
65	K	C	-2.3856
66	G	C	-1.6180
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6696
81	L	C	0.0000
82	Q	C	-1.2301
83	M	C	0.0000
84	N	C	-1.3288
85	S	C	-1.2305
86	L	C	0.0000
87	R	C	-2.4689
88	A	C	-1.8396
89	E	C	-2.3623
90	D	C	0.0000
91	T	C	-0.7192
92	A	C	0.0000
93	I	C	0.7556
94	Y	C	0.0000
95	Y	C	0.5792
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.0994
109	Y	C	-0.2104
110	W	C	0.5562
111	G	C	-0.0702
112	Q	C	-0.8760
113	G	C	-0.0110
114	T	C	0.3247
115	L	C	1.0450
116	H	C	0.0000	mutated: VH116C
117	K	C	-0.3929	mutated: TK117C
118	G	C	-0.8907	mutated: VG118C
119	C	C	-0.2147	mutated: SC119C
120	S	C	-0.7908