Project name: CUR-TS-PCa001_VHH_B7H3_IgC_novel

Status: done

Started: 2026-04-07 22:16:04
Settings
Chain sequence(s) A: QVQLQESGGGLVQAGGSLRLSCAASGSSFSNYAWFRQAPGKEREFVAAISYDGDRTRFTISRDNAKNTLYLQMNSLKPEDTAVYYCARAADGYYDSYGFDYWWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)
Show buried residues

Minimal score value
-3.8698
Maximal score value
1.0145
Average score
-0.8837
Total score value
-99.8622

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.6427
2 V A 0.0000
3 Q A -1.9951
4 L A 0.0000
5 Q A -1.7901
6 E A 0.0000
7 S A -1.2309
8 G A -1.0419
9 G A -0.8474
10 G A -0.0563
11 L A 1.0145
12 V A -0.0584
13 Q A -1.2870
14 A A -1.5733
15 G A -1.3928
16 G A -1.0397
17 S A -1.2087
18 L A -1.0087
19 R A -2.0609
20 L A 0.0000
21 S A -0.9040
22 C A 0.0000
23 A A -1.1524
24 A A 0.0000
25 S A -1.3879
26 G A -1.2376
27 S A -0.8584
28 S A -0.4532
29 F A -0.0335
30 S A -0.5631
31 N A -1.0933
32 Y A 0.0000
33 A A 0.0000
34 W A 0.0000
35 F A -0.2781
36 R A -1.4398
37 Q A -2.4153
38 A A -2.2540
39 P A -1.5131
40 G A -2.0463
41 K A -3.6056
42 E A -3.8698
43 R A -3.2827
44 E A -2.3245
45 F A 0.1303
46 V A 0.1881
47 A A 0.0000
48 A A 0.0000
49 I A 0.2728
50 S A 0.0862
51 Y A 0.0153
52 D A -1.9831
53 G A -1.8430
54 D A -3.0867
55 R A -3.2022
56 T A -1.8882
57 R A -1.7099
58 F A -1.4751
59 T A -1.3759
60 I A -0.3572
61 S A -0.5200
62 R A -1.4439
63 D A -2.1882
64 N A -2.2221
65 A A -1.7948
66 K A -2.5904
67 N A -1.9362
68 T A 0.0000
69 L A 0.0000
70 Y A -0.6393
71 L A 0.0000
72 Q A -1.2974
73 M A 0.0000
74 N A -1.4687
75 S A -1.1969
76 L A 0.0000
77 K A -2.6357
78 P A -2.0274
79 E A -2.3934
80 D A 0.0000
81 T A -0.9985
82 A A 0.0000
83 V A -0.6014
84 Y A 0.0000
85 Y A -0.5142
86 C A 0.0000
87 A A 0.0000
88 R A 0.0000
89 A A 0.0000
90 A A 0.0000
91 D A -1.7962
92 G A -0.7317
93 Y A 0.6146
94 Y A 0.8928
95 D A -0.1886
96 S A 0.2664
97 Y A 0.8400
98 G A 0.2317
99 F A 0.1205
100 D A -1.1287
101 Y A -0.3817
102 W A -0.0972
103 W A -0.1470
104 G A -0.9151
105 Q A -1.5217
106 G A -1.0318
107 T A -1.1325
108 Q A -1.0545
109 V A 0.0000
110 T A -0.3371
111 V A 0.0000
112 S A -0.8247
113 S A -0.9106
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018