Project name: accf67d0e98f8fe

Status: done

Started: 2026-07-13 14:14:46
Settings
Chain sequence(s) A: GPPFARYYNMDMETFDVEFGFPVEPGVEGSGRIVVGETPSGKAASCLYIGPYDEIEKVYDALMKWVRDNGYELSGEAYEIYLDAPAETPPDQLRTQVVLMLKNAGPETETLESQPALLIRTRTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:47)
Show buried residues

Minimal score value
-3.811
Maximal score value
1.7979
Average score
-0.9423
Total score value
-116.8464

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
28 G A -0.1866
29 P A 0.3608
30 P A 0.9181
31 F A 0.0000
32 A A 0.0000
33 R A -0.3520
34 Y A -0.0315
35 Y A -0.4338
36 N A -1.3035
37 M A -0.8745
38 D A -1.9075
39 M A -1.1196
40 E A -1.7368
41 T A -1.1667
42 F A -0.4802
43 D A 0.0000
44 V A 0.0000
45 E A -0.7668
46 F A 0.7948
47 G A 1.3706
48 F A 1.7979
49 P A 0.1908
50 V A -0.6614
51 E A -2.1547
52 P A -1.3797
53 G A -1.1309
54 V A -0.9121
55 E A -1.2463
56 G A -0.0577
57 S A -0.4878
58 G A -0.8723
59 R A -1.3699
60 I A 0.4738
61 V A 1.4826
62 V A 1.4216
63 G A 0.3921
64 E A -1.5750
65 T A 0.0000
66 P A -1.2674
67 S A -1.4343
68 G A -1.4034
69 K A -1.7385
70 A A 0.0000
71 A A 0.0000
72 S A 0.0537
73 C A 0.7358
74 L A 1.0307
75 Y A 0.0000
76 I A 0.8840
77 G A 0.0000
78 P A -1.5846
79 Y A -1.3857
80 D A -2.9373
81 E A -3.1669
82 I A -2.3655
83 E A -3.7302
84 K A -3.6696
85 V A 0.0000
86 Y A -1.8825
87 D A -3.0154
88 A A -1.8363
89 L A 0.0000
90 M A -2.0411
91 K A -3.0420
92 W A -2.0272
93 V A 0.0000
94 R A -3.8110
95 D A -3.6026
96 N A -2.9236
97 G A -2.2887
98 Y A -2.5975
99 E A -3.0860
100 L A -1.6456
101 S A -1.3611
102 G A -1.1535
103 E A -0.7418
104 A A 0.0000
105 Y A 0.0000
106 E A 0.0000
107 I A 0.4528
108 Y A 0.0621
109 L A 0.3119
110 D A -0.8552
111 A A -0.8296
112 P A -1.1081
113 A A -1.0358
114 E A -1.9891
115 T A -1.8823
116 P A -1.7248
117 P A -1.8873
118 D A -2.1949
119 Q A -1.9944
120 L A 0.0000
121 R A -0.5635
122 T A 0.0000
123 Q A 0.3325
124 V A 0.0000
125 V A 0.0000
126 L A 0.0000
127 M A 0.0000
128 L A 0.0000
129 K A -2.6563
130 N A -2.0631
131 A A -1.6607
132 G A -1.2662
133 P A -1.3206
134 E A -2.2287
135 T A -1.6618
136 E A -1.6265
137 T A -1.1482
138 L A -1.2757
139 E A -2.3729
140 S A -1.8606
141 Q A -1.8118
142 P A -0.9626
143 A A 0.0000
144 L A 1.2733
145 L A 0.0000
146 I A 0.1356
147 R A -1.9847
148 T A -1.8006
149 R A -2.0827
150 T A -0.7632
151 T A -0.7634
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018