Project name: GP41 Intein [mutate: VQ22A, MN90A, LA91A]

Status: done

Started: 2026-07-17 16:35:23
Settings
Chain sequence(s) A: SGGALDLKTQVQTPQGMKEISNIQVGDLVLSNTGYNEVLNVFPKSKKKSYKITLEDGKEIICSEEHLFPTQTGEMNISGGLKEGMCLYVKEMMLKKILKIEELDERELIDIEVSGNHLFYANDILTHN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues VQ22A,LA91A,MN90A
Energy difference between WT (input) and mutated protein (by FoldX) 2.33136 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:44)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:59)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-3.8259
Maximal score value
0.0413
Average score
-1.1373
Total score value
-145.5721

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
-2 S A -0.5501
-1 G A -0.6282
0 G A 0.0000
1 A A 0.0000
2 L A 0.0000
3 D A 0.0000
4 L A -1.5722
5 K A -2.3333
6 T A 0.0000
7 Q A -1.9292
8 V A 0.0000
9 Q A -0.7727
10 T A 0.0000
11 P A -0.7406
12 Q A -1.3792
13 G A -0.7766
14 M A -0.5030
15 K A -1.6435
16 E A -2.3523
17 I A 0.0000
18 S A -1.7496
19 N A -2.1849
20 I A 0.0000
21 Q A -2.3343
22 Q A -2.2150 mutated: VQ22A
23 G A -1.7169
24 D A -1.7334
25 L A -0.7627
26 V A 0.0000
27 L A -0.1097
28 S A 0.0000
29 N A -0.9806
30 T A -0.4298
31 G A -0.2452
32 Y A 0.0413
33 N A 0.0000
34 E A -1.7390
35 V A 0.0000
36 L A -0.6341
37 N A -1.1363
38 V A -0.7124
39 F A -0.3366
40 P A -1.0063
41 K A -2.2840
42 S A -2.4658
43 K A -3.6433
44 K A -2.8856
45 K A -2.7284
46 S A 0.0000
47 Y A -1.9133
48 K A -1.7526
49 I A 0.0000
50 T A -2.1347
51 L A 0.0000
52 E A -2.5310
53 D A -2.1786
54 G A -1.8128
55 K A -2.1596
56 E A -2.2157
57 I A 0.0000
58 I A -0.7366
59 C A 0.0000
60 S A 0.0000
61 E A -1.0313
62 E A -0.9328
63 H A 0.0000
64 L A -0.5940
65 F A 0.0000
66 P A -1.0139
67 T A 0.0000
68 Q A -1.4809
69 T A -1.0814
70 G A -1.4193
71 E A -2.0643
72 M A -1.3163
73 N A -1.0376
74 I A -0.6395
75 S A -0.8391
76 G A -1.1063
77 G A -1.0533
78 L A 0.0000
79 K A -2.8188
80 E A -2.9873
81 G A -2.0180
82 M A -1.3314
83 C A -1.2932
84 L A 0.0000
85 Y A -1.1609
86 V A 0.0000
87 K A -2.7504
88 E A -2.8154
89 M A -1.3418
90 N A -1.6602 mutated: MN90A
91 A A -1.2821 mutated: LA91A
92 K A -1.4537
93 K A -2.2222
94 I A 0.0000
95 L A -1.7039
96 K A -2.9601
97 I A -2.4365
98 E A -2.9116
99 E A -3.1076
100 L A -2.1541
101 D A -3.3468
102 E A -3.8259
103 R A -3.1153
104 E A -3.1851
105 L A 0.0000
106 I A 0.0000
107 D A 0.0000
108 I A 0.0000
109 E A -0.9902
110 V A 0.0000
111 S A -0.8803
112 G A -1.0605
113 N A -0.9876
114 H A -1.2165
115 L A 0.0000
116 F A 0.0000
117 Y A 0.0000
118 A A 0.0000
119 N A -1.6712
120 D A -2.0371
121 I A 0.0000
122 L A 0.0000
123 T A 0.0000
124 H A -0.6280
125 N A 0.0000
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018