Project name: query_structure

Status: done

Started: 2026-03-17 00:42:05
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVNAQYMDWYRQAPGKEREWVAAIESFGWWTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVQVGLEYYGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:41)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:42)
Show buried residues

Minimal score value
-3.7318
Maximal score value
2.1548
Average score
-0.6505
Total score value
-74.1521

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4685
2 V A -0.7693
3 Q A -1.1746
4 L A 0.0000
5 V A 0.3045
6 E A 0.0000
7 S A -0.7616
8 G A -1.0525
9 G A -0.8580
10 G A -0.1252
11 L A 0.9175
12 V A 0.0000
13 Q A -1.3240
14 A A -1.5232
15 G A -1.4122
16 G A -0.9563
17 S A -1.2669
18 L A -1.0603
19 R A -2.1390
20 L A 0.0000
21 S A -0.5963
22 C A 0.0000
23 A A -0.4252
24 A A 0.0000
25 S A -0.7518
26 G A -1.0100
27 F A -0.4824
28 P A -0.9378
29 V A 0.0000
30 N A -0.5984
31 A A 0.0308
32 Q A 0.1673
33 Y A 0.7700
34 M A 0.0000
35 D A 0.0000
36 W A 0.0000
37 Y A -0.4238
38 R A -1.2996
39 Q A -2.2744
40 A A -2.1439
41 P A -1.4834
42 G A -2.0205
43 K A -3.4596
44 E A -3.7318
45 R A -3.0946
46 E A -1.8311
47 W A -0.5594
48 V A 0.0000
49 A A 0.0000
50 A A 0.7287
51 I A 0.0000
52 E A 0.9500
53 S A 0.9717
54 F A 1.4897
55 G A 1.0013
56 W A 2.0526
57 W A 2.1548
58 T A 1.3079
59 Y A 0.8337
60 Y A -0.3795
61 A A -1.0934
62 D A -2.3120
63 S A -1.7297
64 V A 0.0000
65 K A -2.5036
66 G A -1.8021
67 R A -1.5441
68 F A 0.0000
69 T A -0.7448
70 I A 0.0000
71 S A -0.7989
72 R A -1.6687
73 D A -2.3039
74 N A -2.4239
75 A A -1.8739
76 K A -2.5569
77 N A -2.0235
78 T A -1.4195
79 V A 0.0000
80 Y A -0.8309
81 L A 0.0000
82 Q A -1.2394
83 M A 0.0000
84 N A -1.4716
85 S A -1.2855
86 L A 0.0000
87 K A -2.5583
88 P A -2.0261
89 E A -2.4110
90 D A 0.0000
91 T A -1.0476
92 A A 0.0000
93 V A -0.7045
94 Y A 0.0000
95 Y A -0.2473
96 C A 0.0000
97 A A 0.0000
98 V A 0.0000
99 Q A -0.4225
100 V A 0.3310
101 G A 0.0575
102 L A 0.7174
103 E A -0.6398
104 Y A -0.1162
105 Y A 0.0148
106 G A -0.2570
107 Q A -1.0915
108 G A 0.0000
109 T A 0.0000
110 Q A -1.2001
111 V A 0.0000
112 T A -0.3870
113 V A 0.0000
114 S A -0.8230
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018