Project name: ade0129d86977a2

Chain sequence(s)	A: MADVQLVESGGGLVQAGGSLRLSCAASGGTISNYGMGWLRQGPGKEREFVGSINWNGATTHYADSVKGRFIISRDNAKNTVYLQMNSLKPEDTGVYYCVAQFSVQPTLQTYDYRGQGTQVTVSEPKTPGGSHHHHHHLE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:10)

• Minimal score value: -3.5664
• Maximal score value: 1.781
• Average score: -0.8773
• Total score value: -121.9452

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.4872
2	A	A	-0.7363
3	D	A	-2.0024
4	V	A	0.0000
5	Q	A	-1.7639
6	L	A	0.0000
7	V	A	0.9215
8	E	A	0.0000
9	S	A	-0.5457
10	G	A	-1.1771
11	G	A	-0.7423
12	G	A	0.2164
13	L	A	1.1080
14	V	A	-0.1666
15	Q	A	-1.8756
16	A	A	-2.1585
17	G	A	-1.5543
18	G	A	-0.8941
19	S	A	-1.2636
20	L	A	-1.0875
21	R	A	-2.1523
22	L	A	0.0000
23	S	A	-0.4996
24	C	A	0.0000
25	A	A	-0.1276
26	A	A	0.0000
27	S	A	-1.1800
28	G	A	-1.3998
29	G	A	-1.2150
30	T	A	-0.7725
31	I	A	0.0000
32	S	A	-1.1523
33	N	A	-0.7941
34	Y	A	0.0000
35	G	A	0.0000
36	M	A	0.0000
37	G	A	0.0000
38	W	A	0.0000
39	L	A	0.0000
40	R	A	0.0000
41	Q	A	-2.1718
42	G	A	0.0000
43	P	A	-1.5404
44	G	A	-2.0177
45	K	A	-3.3826
46	E	A	-3.5664
47	R	A	-2.7051
48	E	A	-1.8698
49	F	A	-0.7885
50	V	A	0.0000
51	G	A	0.0000
52	S	A	0.0000
53	I	A	0.0000
54	N	A	0.0000
55	W	A	-0.2953
56	N	A	-1.6736
57	G	A	-1.1068
58	A	A	-0.4262
59	T	A	-0.5456
60	T	A	-0.4960
61	H	A	-1.2953
62	Y	A	-1.2296
63	A	A	-1.6062
64	D	A	-2.6301
65	S	A	-1.9007
66	V	A	0.0000
67	K	A	-2.6470
68	G	A	-1.6067
69	R	A	-1.3532
70	F	A	0.0000
71	I	A	-0.1096
72	I	A	0.0000
73	S	A	-0.4585
74	R	A	-1.4534
75	D	A	-2.3486
76	N	A	-2.7186
77	A	A	-1.8010
78	K	A	-2.5529
79	N	A	-2.0574
80	T	A	0.0000
81	V	A	0.0000
82	Y	A	0.0000
83	L	A	0.0000
84	Q	A	-1.2433
85	M	A	0.0000
86	N	A	-1.2074
87	S	A	-1.1246
88	L	A	0.0000
89	K	A	-2.3550
90	P	A	-2.1481
91	E	A	-2.2545
92	D	A	0.0000
93	T	A	-0.8442
94	G	A	0.0000
95	V	A	-0.4899
96	Y	A	0.0000
97	Y	A	0.0000
98	C	A	0.0000
99	V	A	0.0000
100	A	A	0.0000
101	Q	A	0.2831
102	F	A	1.5643
103	S	A	1.0413
104	V	A	1.7810
105	Q	A	0.4513
106	P	A	0.0000
107	T	A	-0.0468
108	L	A	0.0097
109	Q	A	-0.8886
110	T	A	-0.7755
111	Y	A	-0.6541
112	D	A	-0.8757
113	Y	A	-1.2015
114	R	A	-1.8259
115	G	A	-1.0258
116	Q	A	-1.3744
117	G	A	0.0000
118	T	A	-0.5978
119	Q	A	-0.9557
120	V	A	0.0000
121	T	A	-0.3780
122	V	A	0.0000
123	S	A	-1.7716
124	E	A	-2.9794
125	P	A	-2.4123
126	K	A	-2.6560
127	T	A	-1.6040
128	P	A	-1.1693
129	G	A	-1.4519
130	G	A	-1.2487
131	S	A	-1.5716
132	H	A	-2.1469
133	H	A	-2.5330
134	H	A	-2.6486
135	H	A	-2.4451
136	H	A	-2.1439
137	H	A	-1.5732
138	L	A	-0.1324
139	E	A	-1.4386