Project name: obj1 [mutate: GQ10C, LI45C, YV95C, TY114C, WT110C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LI45C,GQ10C,TY114C,YV95C,WT110C
Energy difference between WT (input) and mutated protein (by FoldX)	11.6924 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:49)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)

• Minimal score value: -3.2691
• Maximal score value: 1.8918
• Average score: -0.6386
• Total score value: -76.6323

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0226
2	V	C	-1.0532
3	Q	C	-1.2648
4	L	C	0.0000
5	V	C	1.1888
6	E	C	0.0000
7	S	C	0.0227
8	G	C	-0.6478
9	G	C	-0.0595
10	Q	C	0.1114	mutated: GQ10C
11	L	C	0.9435
12	V	C	-0.3209
13	Q	C	-1.3725
14	P	C	-1.5135
15	G	C	-1.3966
16	G	C	-0.9313
17	S	C	-1.2198
18	L	C	-1.0684
19	R	C	-2.0868
20	L	C	0.0000
21	S	C	-0.2480
22	C	C	0.0000
23	A	C	0.0542
24	A	C	0.0000
25	S	C	-0.1292
26	D	C	0.0000
27	F	C	1.5423
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1004
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.0649
40	A	C	-0.8511
41	P	C	-1.2830
42	G	C	-1.3733
43	K	C	-1.9989
44	G	C	-0.7643
45	I	C	0.9893	mutated: LI45C
46	E	C	-0.0988
47	W	C	0.4529
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3569
61	A	C	-1.1400
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6476
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6280
81	L	C	0.0000
82	Q	C	-1.2397
83	M	C	0.0000
84	N	C	-1.3206
85	S	C	-1.2166
86	L	C	0.0000
87	R	C	-2.4839
88	A	C	-1.9170
89	E	C	-2.3502
90	D	C	0.0000
91	T	C	-0.5302
92	A	C	0.0000
93	I	C	1.3062
94	Y	C	0.0000
95	V	C	0.0000	mutated: YV95C
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.0465
101	D	C	-3.2691
102	G	C	-2.0372
103	F	C	-1.1775
104	N	C	-2.3741
105	K	C	-3.0944
106	G	C	-1.7015
107	F	C	-0.7267
108	D	C	-1.0887
109	Y	C	-0.4757
110	T	C	-0.1067	mutated: WT110C
111	G	C	-0.1910
112	Q	C	-0.7611
113	G	C	0.4341
114	Y	C	1.2486	mutated: TY114C
115	L	C	1.8918
116	V	C	0.0000
117	T	C	0.0621
118	V	C	0.0000
119	S	C	-0.8438
120	S	C	-1.0959