Project name: obj1 [mutate: GQ10C, LI45C, YV95C, TY114C, WT110C]

Status: done

Started: 2025-02-10 13:42:33
Settings
Chain sequence(s) C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
input PDB
Selected Chain(s) C
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Mutated residues LI45C,GQ10C,TY114C,YV95C,WT110C
Energy difference between WT (input) and mutated protein (by FoldX) 11.6924 kcal/mol

CAUTION: Your mutation/s can destabilize the protein structure

Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:49)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:15)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:16)
Show buried residues

Minimal score value
-3.2691
Maximal score value
1.8918
Average score
-0.6386
Total score value
-76.6323

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E C -2.0226
2 V C -1.0532
3 Q C -1.2648
4 L C 0.0000
5 V C 1.1888
6 E C 0.0000
7 S C 0.0227
8 G C -0.6478
9 G C -0.0595
10 Q C 0.1114 mutated: GQ10C
11 L C 0.9435
12 V C -0.3209
13 Q C -1.3725
14 P C -1.5135
15 G C -1.3966
16 G C -0.9313
17 S C -1.2198
18 L C -1.0684
19 R C -2.0868
20 L C 0.0000
21 S C -0.2480
22 C C 0.0000
23 A C 0.0542
24 A C 0.0000
25 S C -0.1292
26 D C 0.0000
27 F C 1.5423
28 T C 0.2494
29 F C 0.0000
30 R C -2.0325
31 S C -0.8863
32 Y C -1.2160
33 E C -1.1004
34 M C 0.0000
35 S C 0.0000
36 W C 0.0000
37 V C 0.0000
38 R C 0.0000
39 Q C -0.0649
40 A C -0.8511
41 P C -1.2830
42 G C -1.3733
43 K C -1.9989
44 G C -0.7643
45 I C 0.9893 mutated: LI45C
46 E C -0.0988
47 W C 0.4529
48 V C 0.0000
49 S C 0.0000
50 A C 0.0000
51 I C 0.0000
52 S C -0.5831
53 G C -1.2447
54 S C -1.2286
55 G C -1.0817
56 G C -0.7345
57 S C -0.3025
58 T C 0.1989
59 Y C 0.6077
60 Y C -0.3569
61 A C -1.1400
62 D C -2.3443
63 S C -1.7150
64 V C 0.0000
65 K C -2.3847
66 G C -1.6175
67 R C 0.0000
68 F C 0.0000
69 T C -0.6722
70 I C 0.0000
71 S C -0.5624
72 R C -1.3626
73 D C -1.9805
74 N C -2.1901
75 S C -1.7905
76 K C -2.3163
77 N C -1.6476
78 T C 0.0000
79 L C 0.0000
80 Y C -0.6280
81 L C 0.0000
82 Q C -1.2397
83 M C 0.0000
84 N C -1.3206
85 S C -1.2166
86 L C 0.0000
87 R C -2.4839
88 A C -1.9170
89 E C -2.3502
90 D C 0.0000
91 T C -0.5302
92 A C 0.0000
93 I C 1.3062
94 Y C 0.0000
95 V C 0.0000 mutated: YV95C
96 C C 0.0000
97 A C 0.0000
98 R C 0.0000
99 L C 0.0000
100 R C -3.0465
101 D C -3.2691
102 G C -2.0372
103 F C -1.1775
104 N C -2.3741
105 K C -3.0944
106 G C -1.7015
107 F C -0.7267
108 D C -1.0887
109 Y C -0.4757
110 T C -0.1067 mutated: WT110C
111 G C -0.1910
112 Q C -0.7611
113 G C 0.4341
114 Y C 1.2486 mutated: TY114C
115 L C 1.8918
116 V C 0.0000
117 T C 0.0621
118 V C 0.0000
119 S C -0.8438
120 S C -1.0959
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018