Project name: fold_rfinf_32_12024_10_30_13_30_model_0

Status: done

Started: 2026-03-26 12:03:34
Settings
Chain sequence(s) B: SSFSDFRFIAELQAKAEKASPEEAEKIKAEMAAYFAEK
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:57)
Show buried residues

Minimal score value
-4.5446
Maximal score value
2.0171
Average score
-1.6434
Total score value
-62.4485

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B 0.3980
2 S B 0.6233
3 F B 2.0171
4 S B 0.8945
5 D B 0.0000
6 F B 1.6745
7 R B -0.5685
8 F B 0.2611
9 I B -0.1828
10 A B -0.9909
11 E B -2.3407
12 L B 0.0000
13 Q B -2.6473
14 A B -2.4117
15 K B -3.3124
16 A B -3.8754
17 E B -3.5434
18 K B -3.2421
19 A B -2.9770
20 S B -2.4101
21 P B -2.6839
22 E B -3.7586
23 E B -4.1646
24 A B -4.3025
25 E B -4.5446
26 K B -4.4974
27 I B 0.0000
28 K B -3.9197
29 A B -2.5621
30 E B -2.5761
31 M B -1.2699
32 A B -0.6272
33 A B -0.8065
34 Y B -0.3702
35 F B 0.6768
36 A B -0.5354
37 E B -1.9332
38 K B -1.9396
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018