| Chain sequence(s) |
A: DIQMTQSPSSLSASVGDRVTITCRASQGPTSYLAWYQQKPGKAPKLLIYATKTLQSGVPSRFSGSGSGTDFTLTISRLQPEDFATYYCQQLNSYPLTFGGGTKVEIKGGGGSGGGGSGGGGSGGGGSQVQLVESGGGVVQPGRSLRLSCAASGFTFSNYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGVLDVWGQGTTVTVSS
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:06:04)
[INFO] Auto_mut: Residue number 227 from chain A and a score of 1.639 (valine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Residue number 138 from chain A and a score of 1.336 (valine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Residue number 32 from chain A and a score of 1.138 (tyrosine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Residue number 91 from chain A and a score of 0.904 (leucine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Residue number 94 from chain A and a score of 0.862 (tyrosine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Residue number 132 from chain A and a score of 0.679 (valine) selected for
automated muatation (00:06:08)
[INFO] Auto_mut: Mutating residue number 227 from chain A (valine) into glutamic acid (00:06:08)
[INFO] Auto_mut: Mutating residue number 138 from chain A (valine) into glutamic acid (00:06:08)
[INFO] Auto_mut: Mutating residue number 227 from chain A (valine) into aspartic acid (00:06:08)
[INFO] Auto_mut: Mutating residue number 227 from chain A (valine) into arginine (00:09:34)
[INFO] Auto_mut: Mutating residue number 138 from chain A (valine) into lysine (00:09:37)
[INFO] Auto_mut: Mutating residue number 227 from chain A (valine) into lysine (00:09:54)
[INFO] Auto_mut: Mutating residue number 138 from chain A (valine) into aspartic acid (00:12:39)
[INFO] Auto_mut: Mutating residue number 32 from chain A (tyrosine) into glutamic acid (00:12:52)
[INFO] Auto_mut: Mutating residue number 32 from chain A (tyrosine) into aspartic acid (00:13:43)
[INFO] Auto_mut: Mutating residue number 138 from chain A (valine) into arginine (00:14:56)
[INFO] Auto_mut: Mutating residue number 32 from chain A (tyrosine) into lysine (00:15:13)
[INFO] Auto_mut: Mutating residue number 32 from chain A (tyrosine) into arginine (00:15:29)
[INFO] Auto_mut: Mutating residue number 91 from chain A (leucine) into glutamic acid (00:16:18)
[INFO] Auto_mut: Mutating residue number 91 from chain A (leucine) into aspartic acid (00:16:32)
[INFO] Auto_mut: Mutating residue number 94 from chain A (tyrosine) into glutamic acid (00:16:44)
[INFO] Auto_mut: Mutating residue number 91 from chain A (leucine) into lysine (00:17:23)
[INFO] Auto_mut: Mutating residue number 91 from chain A (leucine) into arginine (00:17:33)
[INFO] Auto_mut: Mutating residue number 94 from chain A (tyrosine) into lysine (00:17:51)
[INFO] Auto_mut: Mutating residue number 94 from chain A (tyrosine) into aspartic acid (00:18:46)
[INFO] Auto_mut: Mutating residue number 132 from chain A (valine) into glutamic acid (00:18:54)
[INFO] Auto_mut: Mutating residue number 132 from chain A (valine) into aspartic acid (00:19:02)
[INFO] Auto_mut: Mutating residue number 94 from chain A (tyrosine) into arginine (00:19:52)
[INFO] Auto_mut: Mutating residue number 132 from chain A (valine) into arginine (00:20:05)
[INFO] Auto_mut: Mutating residue number 132 from chain A (valine) into lysine (00:20:13)
[INFO] Auto_mut: Effect of mutation residue number 227 from chain A (valine) into glutamic
acid: Energy difference: -1.1524 kcal/mol, Difference in average score from
the base case: -0.0334 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 227 from chain A (valine) into lysine:
Energy difference: -1.5772 kcal/mol, Difference in average score from the
base case: -0.0247 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 227 from chain A (valine) into aspartic
acid: Energy difference: -1.5289 kcal/mol, Difference in average score from
the base case: -0.0314 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 227 from chain A (valine) into arginine:
Energy difference: -2.8555 kcal/mol, Difference in average score from the
base case: -0.0318 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 138 from chain A (valine) into glutamic
acid: Energy difference: 0.0980 kcal/mol, Difference in average score from
the base case: -0.0342 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 138 from chain A (valine) into lysine:
Energy difference: -0.3256 kcal/mol, Difference in average score from the
base case: -0.0326 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 138 from chain A (valine) into aspartic
acid: Energy difference: 0.2964 kcal/mol, Difference in average score from
the base case: -0.0347 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 138 from chain A (valine) into arginine:
Energy difference: -0.4830 kcal/mol, Difference in average score from the
base case: -0.0342 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 32 from chain A (tyrosine) into glutamic
acid: Energy difference: 0.1509 kcal/mol, Difference in average score from
the base case: -0.0152 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 32 from chain A (tyrosine) into lysine:
Energy difference: -0.4823 kcal/mol, Difference in average score from the
base case: -0.0392 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 32 from chain A (tyrosine) into aspartic
acid: Energy difference: 0.3343 kcal/mol, Difference in average score from
the base case: -0.0343 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 32 from chain A (tyrosine) into arginine:
Energy difference: -0.7528 kcal/mol, Difference in average score from the
base case: -0.0351 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 91 from chain A (leucine) into glutamic
acid: Energy difference: 0.6599 kcal/mol, Difference in average score from
the base case: -0.0281 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 91 from chain A (leucine) into lysine:
Energy difference: 2.2093 kcal/mol, Difference in average score from the
base case: 0.0008 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 91 from chain A (leucine) into aspartic
acid: Energy difference: 2.5421 kcal/mol, Difference in average score from
the base case: -0.0270 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 91 from chain A (leucine) into arginine:
Energy difference: 2.1581 kcal/mol, Difference in average score from the
base case: 0.0007 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 94 from chain A (tyrosine) into glutamic
acid: Energy difference: 1.9547 kcal/mol, Difference in average score from
the base case: -0.0191 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 94 from chain A (tyrosine) into lysine:
Energy difference: 1.3627 kcal/mol, Difference in average score from the
base case: -0.0208 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 94 from chain A (tyrosine) into aspartic
acid: Energy difference: 1.7413 kcal/mol, Difference in average score from
the base case: -0.0140 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 94 from chain A (tyrosine) into arginine:
Energy difference: 1.0842 kcal/mol, Difference in average score from the
base case: -0.0270 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 132 from chain A (valine) into glutamic
acid: Energy difference: 0.0468 kcal/mol, Difference in average score from
the base case: -0.0219 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 132 from chain A (valine) into lysine:
Energy difference: -0.4977 kcal/mol, Difference in average score from the
base case: -0.0247 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 132 from chain A (valine) into aspartic
acid: Energy difference: 0.3790 kcal/mol, Difference in average score from
the base case: -0.0240 (00:21:34)
[INFO] Auto_mut: Effect of mutation residue number 132 from chain A (valine) into arginine:
Energy difference: -0.4941 kcal/mol, Difference in average score from the
base case: -0.0252 (00:21:34)
[INFO] Main: Simulation completed successfully. (00:21:38)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | D | A | -2.0077 | |
| 2 | I | A | -1.7731 | |
| 3 | Q | A | -2.1873 | |
| 4 | M | A | 0.0000 | |
| 5 | T | A | -1.2884 | |
| 6 | Q | A | -0.9758 | |
| 7 | S | A | -0.8068 | |
| 8 | P | A | -0.6021 | |
| 9 | S | A | -0.8485 | |
| 10 | S | A | -1.1094 | |
| 11 | L | A | -0.7742 | |
| 12 | S | A | -1.1969 | |
| 13 | A | A | 0.0000 | |
| 14 | S | A | -0.5942 | |
| 15 | V | A | 0.3246 | |
| 16 | G | A | -1.0681 | |
| 17 | D | A | -2.0791 | |
| 18 | R | A | -2.8124 | |
| 19 | V | A | 0.0000 | |
| 20 | T | A | -0.6192 | |
| 21 | I | A | 0.0000 | |
| 22 | T | A | -0.8021 | |
| 23 | C | A | 0.0000 | |
| 24 | R | A | -2.6278 | |
| 25 | A | A | 0.0000 | |
| 26 | S | A | -1.9986 | |
| 27 | Q | A | -2.3234 | |
| 28 | G | A | -1.7108 | |
| 29 | P | A | -1.0445 | |
| 30 | T | A | 0.0000 | |
| 31 | S | A | 0.0781 | |
| 32 | Y | A | 1.1379 | |
| 33 | L | A | 0.0000 | |
| 34 | A | A | 0.0000 | |
| 35 | W | A | 0.0000 | |
| 36 | Y | A | 0.0000 | |
| 37 | Q | A | 0.0000 | |
| 38 | Q | A | 0.0000 | |
| 39 | K | A | -1.6593 | |
| 40 | P | A | -1.3011 | |
| 41 | G | A | -1.6748 | |
| 42 | K | A | -2.5621 | |
| 43 | A | A | -1.5933 | |
| 44 | P | A | 0.0000 | |
| 45 | K | A | -1.4072 | |
| 46 | L | A | 0.0000 | |
| 47 | L | A | 0.0000 | |
| 48 | I | A | 0.0000 | |
| 49 | Y | A | 0.6386 | |
| 50 | A | A | 0.4366 | |
| 51 | T | A | 0.0000 | |
| 52 | K | A | -1.4935 | |
| 53 | T | A | -0.5518 | |
| 54 | L | A | -0.1018 | |
| 55 | Q | A | -0.4642 | |
| 56 | S | A | -0.3915 | |
| 57 | G | A | -0.5234 | |
| 58 | V | A | -0.3512 | |
| 59 | P | A | -0.3292 | |
| 60 | S | A | -0.5724 | |
| 61 | R | A | -1.1548 | |
| 62 | F | A | 0.0000 | |
| 63 | S | A | -0.6811 | |
| 64 | G | A | -0.8631 | |
| 65 | S | A | -1.1555 | |
| 66 | G | A | -1.3488 | |
| 67 | S | A | -0.9378 | |
| 68 | G | A | -1.3089 | |
| 69 | T | A | -1.7938 | |
| 70 | D | A | -2.0534 | |
| 71 | F | A | 0.0000 | |
| 72 | T | A | -0.9239 | |
| 73 | L | A | 0.0000 | |
| 74 | T | A | -0.8200 | |
| 75 | I | A | 0.0000 | |
| 76 | S | A | -2.0841 | |
| 77 | R | A | -2.7662 | |
| 78 | L | A | 0.0000 | |
| 79 | Q | A | -1.1403 | |
| 80 | P | A | -0.5713 | |
| 81 | E | A | -1.2921 | |
| 82 | D | A | 0.0000 | |
| 83 | F | A | -0.5951 | |
| 84 | A | A | 0.0000 | |
| 85 | T | A | -1.0180 | |
| 86 | Y | A | 0.0000 | |
| 87 | Y | A | 0.0000 | |
| 88 | C | A | 0.0000 | |
| 89 | Q | A | 0.0000 | |
| 90 | Q | A | 0.0000 | |
| 91 | L | A | 0.9036 | |
| 92 | N | A | -0.0301 | |
| 93 | S | A | 0.0782 | |
| 94 | Y | A | 0.8624 | |
| 95 | P | A | -0.0951 | |
| 96 | L | A | 0.0000 | |
| 97 | T | A | -0.5774 | |
| 98 | F | A | 0.0000 | |
| 99 | G | A | 0.0000 | |
| 100 | G | A | -1.2578 | |
| 101 | G | A | 0.0000 | |
| 102 | T | A | 0.0000 | |
| 103 | K | A | -1.9666 | |
| 104 | V | A | 0.0000 | |
| 105 | E | A | -1.7323 | |
| 106 | I | A | -0.1786 | |
| 107 | K | A | -1.6589 | |
| 108 | G | A | -1.5589 | |
| 109 | G | A | -1.4369 | |
| 110 | G | A | -1.2910 | |
| 111 | G | A | -1.2823 | |
| 112 | S | A | -1.0284 | |
| 113 | G | A | -1.1035 | |
| 114 | G | A | -1.1837 | |
| 115 | G | A | -1.2006 | |
| 116 | G | A | -1.1279 | |
| 117 | S | A | -0.9265 | |
| 118 | G | A | -1.0189 | |
| 119 | G | A | -1.1787 | |
| 120 | G | A | -1.1200 | |
| 121 | G | A | -1.0100 | |
| 122 | S | A | -0.9689 | |
| 123 | G | A | -1.0551 | |
| 124 | G | A | -1.2942 | |
| 125 | G | A | -1.2873 | |
| 126 | G | A | -1.2509 | |
| 127 | S | A | -1.1839 | |
| 128 | Q | A | -1.4761 | |
| 129 | V | A | -0.2971 | |
| 130 | Q | A | -0.6779 | |
| 131 | L | A | 0.0000 | |
| 132 | V | A | 0.6788 | |
| 133 | E | A | 0.0000 | |
| 134 | S | A | -0.4693 | |
| 135 | G | A | -0.9639 | |
| 136 | G | A | -0.3632 | |
| 137 | G | A | 0.3238 | |
| 138 | V | A | 1.3362 | |
| 139 | V | A | 0.0000 | |
| 140 | Q | A | -1.8393 | |
| 141 | P | A | -2.1146 | |
| 142 | G | A | -2.0944 | |
| 143 | R | A | -2.7623 | |
| 144 | S | A | -2.0533 | |
| 145 | L | A | -1.2955 | |
| 146 | R | A | -1.9648 | |
| 147 | L | A | 0.0000 | |
| 148 | S | A | -0.4243 | |
| 149 | C | A | 0.0000 | |
| 150 | A | A | -0.2146 | |
| 151 | A | A | 0.0000 | |
| 152 | S | A | -0.6510 | |
| 153 | G | A | -0.6239 | |
| 154 | F | A | -0.2522 | |
| 155 | T | A | -0.3930 | |
| 156 | F | A | 0.0000 | |
| 157 | S | A | -0.9483 | |
| 158 | N | A | -1.0718 | |
| 159 | Y | A | 0.1851 | |
| 160 | G | A | -0.0096 | |
| 161 | M | A | 0.0000 | |
| 162 | H | A | 0.0000 | |
| 163 | W | A | 0.0000 | |
| 164 | V | A | 0.0000 | |
| 165 | R | A | 0.0000 | |
| 166 | Q | A | -0.7719 | |
| 167 | A | A | -1.2024 | |
| 168 | P | A | -1.1668 | |
| 169 | G | A | -1.4531 | |
| 170 | K | A | -2.2594 | |
| 171 | G | A | -1.4140 | |
| 172 | L | A | 0.0000 | |
| 173 | E | A | -0.9232 | |
| 174 | W | A | 0.0000 | |
| 175 | V | A | 0.0000 | |
| 176 | A | A | 0.0000 | |
| 177 | V | A | 0.0000 | |
| 178 | I | A | 0.0000 | |
| 179 | S | A | -0.7578 | |
| 180 | Y | A | -0.2580 | |
| 181 | D | A | -1.8465 | |
| 182 | G | A | -1.4273 | |
| 183 | S | A | -1.3832 | |
| 184 | N | A | -1.7583 | |
| 185 | K | A | -1.2110 | |
| 186 | Y | A | -0.1773 | |
| 187 | Y | A | -0.5994 | |
| 188 | A | A | 0.0000 | |
| 189 | D | A | -2.4163 | |
| 190 | S | A | -1.7292 | |
| 191 | V | A | 0.0000 | |
| 192 | K | A | -2.5329 | |
| 193 | G | A | -1.7703 | |
| 194 | R | A | -1.5287 | |
| 195 | F | A | 0.0000 | |
| 196 | T | A | -0.8641 | |
| 197 | I | A | 0.0000 | |
| 198 | S | A | -0.5065 | |
| 199 | R | A | -1.0533 | |
| 200 | D | A | -1.7717 | |
| 201 | N | A | -1.9455 | |
| 202 | S | A | -1.6171 | |
| 203 | K | A | -2.4000 | |
| 204 | N | A | -1.7679 | |
| 205 | T | A | -1.0612 | |
| 206 | L | A | 0.0000 | |
| 207 | Y | A | -0.5274 | |
| 208 | L | A | 0.0000 | |
| 209 | Q | A | -1.1304 | |
| 210 | M | A | 0.0000 | |
| 211 | N | A | -1.8918 | |
| 212 | S | A | -1.7655 | |
| 213 | L | A | 0.0000 | |
| 214 | R | A | -2.7485 | |
| 215 | A | A | -1.8121 | |
| 216 | E | A | -2.3312 | |
| 217 | D | A | 0.0000 | |
| 218 | T | A | -0.6560 | |
| 219 | A | A | 0.0000 | |
| 220 | V | A | 0.1376 | |
| 221 | Y | A | 0.0000 | |
| 222 | Y | A | 0.0000 | |
| 223 | C | A | 0.0000 | |
| 224 | A | A | 0.0000 | |
| 225 | R | A | 0.1652 | |
| 226 | G | A | 0.6386 | |
| 227 | V | A | 1.6388 | |
| 228 | L | A | 0.0000 | |
| 229 | D | A | -0.0832 | |
| 230 | V | A | 0.0449 | |
| 231 | W | A | -0.4661 | |
| 232 | G | A | 0.0000 | |
| 233 | Q | A | -1.4036 | |
| 234 | G | A | 0.0000 | |
| 235 | T | A | -0.1749 | |
| 236 | T | A | 0.1949 | |
| 237 | V | A | 0.0000 | |
| 238 | T | A | 0.0130 | |
| 239 | V | A | 0.0000 | |
| 240 | S | A | -0.6857 | |
| 241 | S | A | -0.6797 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR227A | -2.8555 | -0.0318 | View | CSV | PDB |
| VD227A | -1.5289 | -0.0314 | View | CSV | PDB |
| YR32A | -0.7528 | -0.0351 | View | CSV | PDB |
| YK32A | -0.4823 | -0.0392 | View | CSV | PDB |
| VR138A | -0.483 | -0.0342 | View | CSV | PDB |
| VK138A | -0.3256 | -0.0326 | View | CSV | PDB |
| VR132A | -0.4941 | -0.0252 | View | CSV | PDB |
| VK132A | -0.4977 | -0.0247 | View | CSV | PDB |
| LE91A | 0.6599 | -0.0281 | View | CSV | PDB |
| YR94A | 1.0842 | -0.027 | View | CSV | PDB |
| YK94A | 1.3627 | -0.0208 | View | CSV | PDB |
| LD91A | 2.5421 | -0.027 | View | CSV | PDB |