Project name: query_structure

Status: done

Started: 2026-03-16 20:41:23
Settings
Chain sequence(s) A: MAAGSWKATRLLLAILVALVAFSYQVKRKTFIRIEEVSALESSVKETLEYVTDEYNKKSEDLYNFRILRILKIMKQVTGHLEYHITVEMQRTTCLKTETSLCDIQKGELHKKIQCYFSVYAIPWVEVFKILKKNCTDIS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:24)
Show buried residues

Minimal score value
-3.5918
Maximal score value
4.7213
Average score
-0.3082
Total score value
-42.8394

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.9727
2 A A 0.4447
3 A A 0.0937
4 G A -0.4234
5 S A -0.2866
6 W A -0.0344
7 K A -1.2972
8 A A -0.2155
9 T A 0.2061
10 R A -0.3415
11 L A 1.8987
12 L A 2.8966
13 L A 2.9743
14 A A 3.1771
15 I A 4.4694
16 L A 4.5875
17 V A 4.7213
18 A A 4.0449
19 L A 4.4747
20 V A 4.0018
21 A A 3.1894
22 F A 3.2920
23 S A 1.8377
24 Y A 0.9799
25 Q A -0.6434
26 V A -0.5091
27 K A -2.3296
28 R A -3.0521
29 K A -2.2288
30 T A -0.5372
31 F A 1.6201
32 I A 1.5285
33 R A 0.0483
34 I A 0.3406
35 E A -1.7376
36 E A -2.3861
37 V A -1.1329
38 S A -0.6547
39 A A -0.3841
40 L A 0.5774
41 E A -1.1301
42 S A -1.2970
43 S A -1.2411
44 V A 0.0000
45 K A -2.5226
46 E A -3.3288
47 T A 0.0000
48 L A 0.0000
49 E A -3.3043
50 Y A -2.2703
51 V A 0.0000
52 T A -2.3316
53 D A -3.3774
54 E A -2.6207
55 Y A 0.0000
56 N A 0.0000
57 K A -3.5918
58 K A -3.3568
59 S A -2.3975
60 E A -2.3240
61 D A -0.8738
62 L A 0.9619
63 Y A 0.1016
64 N A -1.1664
65 F A 0.0000
66 R A -2.4771
67 I A -1.1043
68 L A -0.4132
69 R A -1.1818
70 I A 0.2495
71 L A 0.3673
72 K A -1.0429
73 I A 0.0000
74 M A -1.3581
75 K A -1.0924
76 Q A -0.3497
77 V A 0.4645
78 T A 0.6540
79 G A -0.0845
80 H A -0.2649
81 L A -0.2307
82 E A -0.0892
83 Y A 0.0000
84 H A -0.6832
85 I A 0.0000
86 T A -0.2829
87 V A 0.0000
88 E A 0.0000
89 M A 0.0000
90 Q A -1.4487
91 R A -1.0711
92 T A 0.0000
93 T A -0.3628
94 C A 0.0000
95 L A 0.1988
96 K A -1.1303
97 T A -0.8577
98 E A -1.1716
99 T A -0.4616
100 S A 0.0799
101 L A 1.0206
102 C A -0.1912
103 D A -1.6766
104 I A -1.3618
105 Q A 0.0000
106 K A -2.5028
107 G A -2.0677
108 E A -2.1925
109 L A -0.9202
110 H A -1.7031
111 K A -1.6793
112 K A -1.4747
113 I A 0.0000
114 Q A -0.7588
115 C A 0.0000
116 Y A -0.6792
117 F A 0.0000
118 S A 0.0000
119 V A 0.0000
120 Y A -0.1213
121 A A 0.0000
122 I A 0.8936
123 P A 0.4303
124 W A 1.7594
125 V A 1.9644
126 E A -0.3202
127 V A 0.9848
128 F A -0.1774
129 K A -1.3420
130 I A -1.0298
131 L A -0.8696
132 K A -2.2970
133 K A -2.1497
134 N A -1.9016
135 C A -0.9085
136 T A -1.0734
137 D A -1.8294
138 I A -0.6915
139 S A -0.9410
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018