Project name: query_structure

Status: done

Started: 2026-03-16 21:45:36
Settings
Chain sequence(s) A: MLPAPKNLVVSRVTEDSARLSWTAPDAAFDSFRIRYVEVIAWGEAIWLVVPGSERSYDLTGLKPGTEYVVVIDGVKGGKTSIPLIAHFTT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:40)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:41)
Show buried residues

Minimal score value
-3.0406
Maximal score value
2.8129
Average score
-0.4378
Total score value
-39.3985

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.0759
2 L A 0.4826
3 P A 0.1485
4 A A 0.0937
5 P A 0.0000
6 K A -2.0137
7 N A -1.1477
8 L A 0.2400
9 V A 1.0735
10 V A 0.1522
11 S A -0.6382
12 R A -2.0142
13 V A -1.0297
14 T A -1.7828
15 E A -3.0406
16 D A -2.7517
17 S A -2.0845
18 A A 0.0000
19 R A -1.2519
20 L A 0.0000
21 S A -0.3872
22 W A 0.0000
23 T A -1.2785
24 A A -1.4204
25 P A -1.4111
26 D A -2.2684
27 A A -1.4287
28 A A -1.1622
29 F A 0.0000
30 D A -2.6052
31 S A -1.1246
32 F A 0.0000
33 R A 0.0587
34 I A 0.0000
35 R A 0.5115
36 Y A 0.4654
37 V A 0.5560
38 E A 0.6755
39 V A 2.3751
40 I A 2.8129
41 A A 1.5454
42 W A 1.7241
43 G A 0.3683
44 E A -1.2463
45 A A -0.1319
46 I A 0.6909
47 W A 1.4958
48 L A 1.5635
49 V A 1.7526
50 V A 0.0000
51 P A -0.7954
52 G A 0.0000
53 S A -1.6011
54 E A -1.4930
55 R A -1.1445
56 S A -0.6697
57 Y A -0.7586
58 D A -1.6862
59 L A 0.0000
60 T A -1.3601
61 G A -1.5028
62 L A 0.0000
63 K A -2.9947
64 P A -2.5416
65 G A -1.8001
66 T A -1.1507
67 E A -0.6825
68 Y A 0.0000
69 V A 0.2865
70 V A 0.0000
71 V A 0.0000
72 I A 0.0000
73 D A 0.0000
74 G A 0.0000
75 V A -1.1587
76 K A -2.2072
77 G A -1.9117
78 G A -1.9202
79 K A -2.0780
80 T A -0.6980
81 S A 0.0000
82 I A 1.6687
83 P A 0.7350
84 L A 1.1055
85 I A 1.8171
86 A A 0.7531
87 H A -0.2951
88 F A 0.0000
89 T A -1.1036
90 T A -1.8535
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018