Project name: aeef3b0792f6a00

Status: done

Started: 2024-06-19 14:39:27
Settings
Chain sequence(s) A: VGSLNCIVAVSQNMMGIGKNGDLPWPPPLRNEFRYFQRRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEEKGIKYKFEVYEKND
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:36)
Show buried residues

Minimal score value
-3.7076
Maximal score value
0.7009
Average score
-1.1835
Total score value
-220.1394

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 0.7009
2 G A 0.5314
3 S A 0.0547
4 L A 0.1028
5 N A 0.0000
6 C A 0.0000
7 I A 0.0000
8 V A 0.0000
9 A A -0.0141
10 V A 0.0000
11 S A 0.0000
12 Q A -2.2072
13 N A -1.5674
14 M A -0.8774
15 G A 0.0000
16 I A -0.3148
17 G A -1.4365
18 K A -2.6053
19 N A -2.8010
20 G A -2.2371
21 D A -2.5110
22 L A -1.0273
23 P A 0.0000
24 W A 0.0000
25 P A -0.8598
26 P A -0.9432
27 L A 0.0000
28 R A -2.5298
29 N A -1.9895
30 E A 0.0000
31 F A -1.3034
32 R A -2.7005
33 Y A 0.0000
34 F A -1.0083
35 Q A -2.1317
36 R A -2.4276
37 M A -1.1063
38 T A 0.0000
39 T A -1.3788
40 T A -0.9543
41 S A -1.0294
42 S A -0.5638
43 V A -0.8395
44 E A -2.1917
45 G A -2.1311
46 K A -2.2251
47 Q A -2.0248
48 N A 0.0000
49 L A 0.0000
50 V A 0.0000
51 I A 0.0000
52 M A 0.0000
53 G A -0.7790
54 K A -1.7696
55 K A -1.8568
56 T A -0.9430
57 W A 0.0000
58 F A -0.1302
59 S A -0.9562
60 I A -1.0855
61 P A -1.7399
62 E A -3.1644
63 K A -3.3756
64 N A -3.2608
65 R A -2.5386
66 P A -2.0945
67 L A 0.0000
68 K A -2.3677
69 G A -1.6124
70 R A -1.2464
71 I A -0.7532
72 N A 0.0000
73 L A 0.0000
74 V A 0.0000
75 L A -1.4267
76 S A 0.0000
77 R A -3.5791
78 E A -3.5797
79 L A -2.8729
80 K A -3.3913
81 E A -3.0282
82 P A -1.7779
83 P A 0.0000
84 Q A -2.0193
85 G A -1.7558
86 A A 0.0000
87 H A -1.2909
88 F A -0.2672
89 L A -1.2511
90 S A 0.0000
91 R A -3.0981
92 S A -2.1615
93 L A 0.0000
94 D A -2.4244
95 D A -2.8132
96 A A 0.0000
97 L A -1.5354
98 K A -2.9396
99 L A -2.0403
100 T A 0.0000
101 E A -2.6447
102 Q A -2.4746
103 P A -2.1287
104 E A -2.4795
105 L A 0.0000
106 A A -2.1115
107 N A -2.5821
108 K A -2.6703
109 V A 0.0000
110 D A 0.0000
111 M A 0.1097
112 V A 0.0000
113 W A 0.0000
114 I A 0.0000
115 V A 0.2067
116 G A 0.0000
117 G A -0.5368
118 S A -0.3171
119 S A -0.9370
120 V A 0.0000
121 Y A 0.0000
122 K A -2.6266
123 E A -2.2955
124 A A 0.0000
125 M A 0.0000
126 N A -2.5128
127 H A -1.8349
128 P A -1.6422
129 G A -1.8180
130 H A -1.9420
131 L A 0.0000
132 K A -0.6937
133 L A 0.0000
134 F A 0.0000
135 V A 0.0000
136 T A 0.0000
137 R A -1.4882
138 I A 0.0000
139 M A -1.5908
140 Q A -2.0226
141 D A -2.8065
142 F A -2.1226
143 E A -2.7163
144 S A -2.2668
145 D A -2.5464
146 T A -0.9061
147 F A 0.5499
148 F A 0.0000
149 P A -1.1657
150 E A -1.9559
151 I A -2.0866
152 D A -2.8546
153 L A -1.2044
154 E A -2.7458
155 K A -3.7076
156 Y A 0.0000
157 K A -1.9371
158 L A 0.1096
159 L A -0.4237
160 P A -0.9463
161 E A -1.6254
162 Y A -0.5665
163 P A -0.4916
164 G A -0.3140
165 V A 0.0430
166 L A 0.5668
167 S A -0.7695
168 D A -1.4115
169 V A -1.0253
170 Q A -1.6819
171 E A -3.0380
172 E A -2.9564
173 K A -2.9604
174 G A -2.1930
175 I A 0.0000
176 K A -2.6281
177 Y A 0.0000
178 K A -1.3542
179 F A 0.0000
180 E A 0.0000
181 V A 0.0000
182 Y A 0.0000
183 E A -1.3292
184 K A 0.0000
185 N A -3.0921
186 D A -3.0717
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018