Project name: query_structure

Status: done

Started: 2026-03-16 23:39:12
Settings
Chain sequence(s) A: GSVSSVPTKLEVVAATPTSLLISWDAPAVTVDFYVITYGETGGYSYPWQEFEVPGSKSTATISGLKPGVDYTITVYADYGQYFYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:03)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:03)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:03)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:03)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:21)
Show buried residues

Minimal score value
-2.6002
Maximal score value
2.6267
Average score
-0.3603
Total score value
-33.5047

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.1189
2 S A 0.3560
3 V A 1.5997
4 S A 0.7370
5 S A 1.1187
6 V A 0.4293
7 P A 0.0000
8 T A -1.5165
9 K A -2.5330
10 L A 0.0000
11 E A -1.8767
12 V A 0.1334
13 V A 1.5608
14 A A 0.9124
15 A A 0.3384
16 T A -0.3490
17 P A -1.1629
18 T A -1.0398
19 S A -0.5362
20 L A 0.0000
21 L A 0.7708
22 I A 0.0000
23 S A -0.9128
24 W A 0.0000
25 D A -2.4074
26 A A -1.1173
27 P A 0.1418
28 A A 0.5545
29 V A 0.8564
30 T A 0.0018
31 V A -0.3881
32 D A -1.3787
33 F A -1.1207
34 Y A 0.0000
35 V A 0.0000
36 I A 0.0000
37 T A -0.9763
38 Y A -0.7183
39 G A 0.0000
40 E A -1.4058
41 T A -1.1130
42 G A -0.6015
43 G A 0.0681
44 Y A 1.3109
45 S A 0.7807
46 Y A 1.3758
47 P A 0.5387
48 W A 0.0171
49 Q A -1.3747
50 E A -2.2584
51 F A -1.3687
52 E A -1.8846
53 V A 0.0000
54 P A -1.4625
55 G A -1.3470
56 S A -1.3142
57 K A -1.9061
58 S A -1.2971
59 T A -0.6970
60 A A 0.0000
61 T A 0.2489
62 I A 0.0000
63 S A -0.6525
64 G A -1.0367
65 L A 0.0000
66 K A -2.4874
67 P A -1.7998
68 G A -1.5575
69 V A -1.6294
70 D A -2.2029
71 Y A 0.0000
72 T A -0.9575
73 I A 0.0000
74 T A 0.0000
75 V A 0.0000
76 Y A 0.6762
77 A A 0.0000
78 D A 0.3213
79 Y A 0.9482
80 G A -0.2250
81 Q A -0.1115
82 Y A 1.9108
83 F A 2.6267
84 Y A 1.7528
85 S A 1.1600
86 P A 0.5464
87 I A 0.2329
88 S A -0.4572
89 I A -0.6996
90 N A -1.7416
91 Y A -1.4920
92 R A -2.6002
93 T A -1.6972
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018