Project name: RSVAseq95

Status: done

Started: 2026-06-14 10:02:45
Settings
Chain sequence(s) A: QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGQGLEAVAAISSGSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADLRGAAGRVYEYNYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)
Show buried residues

Minimal score value
-2.9146
Maximal score value
1.7895
Average score
-0.5084
Total score value
-62.537

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.5432
2 V A -0.9737
3 Q A -1.0901
4 L A 0.0000
5 V A 1.1305
6 E A 0.3984
7 S A -0.0903
8 G A -0.6440
9 G A 0.1446
10 G A 0.6891
11 L A 1.3982
12 V A -0.1092
13 Q A -1.4433
14 P A -1.8082
15 G A -1.5249
16 G A -1.0044
17 S A -1.2887
18 L A -0.8930
19 R A -2.1238
20 L A 0.0000
21 S A -0.3877
22 C A 0.0000
23 A A -0.1367
24 A A 0.0000
25 S A -0.9377
26 G A -1.0635
27 F A -0.4653
28 T A -0.1662
29 F A 0.0000
30 S A -0.7818
31 S A -0.3543
32 Y A 0.0000
33 A A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.3689
38 R A 0.0000
39 Q A -0.3704
40 A A -0.8272
41 P A -0.9393
42 G A -1.2235
43 Q A -1.6979
44 G A -0.9451
45 L A 0.2094
46 E A -0.4573
47 A A 0.1226
48 V A 0.0000
49 A A 0.0000
50 A A 0.3778
51 I A 0.0000
52 S A -0.5066
53 S A -0.6684
54 G A -0.7513
55 S A -0.6354
56 G A -0.5415
57 S A -0.2742
58 T A 0.3144
59 Y A 0.6799
60 Y A -0.3244
61 A A 0.0000
62 D A -2.3428
63 S A -1.7270
64 V A 0.0000
65 K A -2.4626
66 G A -1.7513
67 R A -1.5247
68 F A 0.0000
69 T A -0.7333
70 I A 0.0000
71 S A -0.4511
72 R A -1.2346
73 D A -1.9860
74 N A -2.1165
75 S A -1.8254
76 K A -2.5621
77 N A -1.9382
78 T A 0.0000
79 L A 0.0000
80 Y A -0.6598
81 L A 0.0000
82 Q A -1.2585
83 M A 0.0000
84 N A -1.5366
85 S A -1.3927
86 L A 0.0000
87 R A -2.9146
88 A A -2.0324
89 E A -2.4553
90 D A 0.0000
91 T A -0.4653
92 A A 0.0000
93 V A 1.0639
94 Y A 0.0000
95 Y A 0.5687
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 D A 0.0000
100 L A 0.3970
101 R A -1.0087
102 G A -0.8667
103 A A -0.7307
104 A A -0.7860
105 G A -1.0180
106 R A -1.3623
107 V A 0.6104
108 Y A 0.6122
109 E A -1.1140
110 Y A -0.4242
111 N A -1.0157
112 Y A -0.1334
113 W A 0.2732
114 G A 0.0197
115 Q A -0.8038
116 G A 0.1977
117 T A 0.6810
118 L A 1.7895
119 V A 0.0000
120 T A 0.3372
121 V A 0.0000
122 S A -0.7872
123 S A -0.5073
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018