Project name: RSVAseq95

Chain sequence(s)	A: QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMGWFRQAPGQGLEAVAAISSGSGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAADLRGAAGRVYEYNYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)

• Minimal score value: -2.9146
• Maximal score value: 1.7895
• Average score: -0.5084
• Total score value: -62.537

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.5432
2	V	A	-0.9737
3	Q	A	-1.0901
4	L	A	0.0000
5	V	A	1.1305
6	E	A	0.3984
7	S	A	-0.0903
8	G	A	-0.6440
9	G	A	0.1446
10	G	A	0.6891
11	L	A	1.3982
12	V	A	-0.1092
13	Q	A	-1.4433
14	P	A	-1.8082
15	G	A	-1.5249
16	G	A	-1.0044
17	S	A	-1.2887
18	L	A	-0.8930
19	R	A	-2.1238
20	L	A	0.0000
21	S	A	-0.3877
22	C	A	0.0000
23	A	A	-0.1367
24	A	A	0.0000
25	S	A	-0.9377
26	G	A	-1.0635
27	F	A	-0.4653
28	T	A	-0.1662
29	F	A	0.0000
30	S	A	-0.7818
31	S	A	-0.3543
32	Y	A	0.0000
33	A	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.3689
38	R	A	0.0000
39	Q	A	-0.3704
40	A	A	-0.8272
41	P	A	-0.9393
42	G	A	-1.2235
43	Q	A	-1.6979
44	G	A	-0.9451
45	L	A	0.2094
46	E	A	-0.4573
47	A	A	0.1226
48	V	A	0.0000
49	A	A	0.0000
50	A	A	0.3778
51	I	A	0.0000
52	S	A	-0.5066
53	S	A	-0.6684
54	G	A	-0.7513
55	S	A	-0.6354
56	G	A	-0.5415
57	S	A	-0.2742
58	T	A	0.3144
59	Y	A	0.6799
60	Y	A	-0.3244
61	A	A	0.0000
62	D	A	-2.3428
63	S	A	-1.7270
64	V	A	0.0000
65	K	A	-2.4626
66	G	A	-1.7513
67	R	A	-1.5247
68	F	A	0.0000
69	T	A	-0.7333
70	I	A	0.0000
71	S	A	-0.4511
72	R	A	-1.2346
73	D	A	-1.9860
74	N	A	-2.1165
75	S	A	-1.8254
76	K	A	-2.5621
77	N	A	-1.9382
78	T	A	0.0000
79	L	A	0.0000
80	Y	A	-0.6598
81	L	A	0.0000
82	Q	A	-1.2585
83	M	A	0.0000
84	N	A	-1.5366
85	S	A	-1.3927
86	L	A	0.0000
87	R	A	-2.9146
88	A	A	-2.0324
89	E	A	-2.4553
90	D	A	0.0000
91	T	A	-0.4653
92	A	A	0.0000
93	V	A	1.0639
94	Y	A	0.0000
95	Y	A	0.5687
96	C	A	0.0000
97	A	A	0.0000
98	A	A	0.0000
99	D	A	0.0000
100	L	A	0.3970
101	R	A	-1.0087
102	G	A	-0.8667
103	A	A	-0.7307
104	A	A	-0.7860
105	G	A	-1.0180
106	R	A	-1.3623
107	V	A	0.6104
108	Y	A	0.6122
109	E	A	-1.1140
110	Y	A	-0.4242
111	N	A	-1.0157
112	Y	A	-0.1334
113	W	A	0.2732
114	G	A	0.0197
115	Q	A	-0.8038
116	G	A	0.1977
117	T	A	0.6810
118	L	A	1.7895
119	V	A	0.0000
120	T	A	0.3372
121	V	A	0.0000
122	S	A	-0.7872
123	S	A	-0.5073