Project name: query_structure

Status: done

Started: 2026-03-17 00:08:05
Settings
Chain sequence(s) A: MGSSHHHHHHYYLEVDNKFNKEFQWAWQEILVLPNLNKYQKEAFKTSLKDDPSQSANLLAEAKKLNDAQAPKVD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:42)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:43)
Show buried residues

Minimal score value
-3.2969
Maximal score value
2.0781
Average score
-1.1498
Total score value
-85.088

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7709
2 G A -0.1925
3 S A -0.7030
4 S A -1.3032
5 H A -2.0404
6 H A -2.4520
7 H A -2.6022
8 H A -2.4294
9 H A -1.8283
10 H A -0.8391
11 Y A 1.2037
12 Y A 2.0781
13 L A 1.6559
14 E A -0.7998
15 V A -0.0487
16 D A -2.3249
17 N A -2.5443
18 K A -2.5097
19 F A -0.4464
20 N A -1.6425
21 K A -2.6844
22 E A -1.8950
23 F A -1.2463
24 Q A -0.7475
25 W A -0.3416
26 A A 0.0000
27 W A -0.3629
28 Q A 0.2416
29 E A 0.2084
30 I A 0.0000
31 L A 0.6620
32 V A 1.4981
33 L A 0.0000
34 P A -0.4739
35 N A -1.2584
36 L A 0.0000
37 N A -1.6316
38 K A -1.9630
39 Y A -0.5705
40 Q A -0.9909
41 K A -1.3231
42 E A -1.9221
43 A A -1.2161
44 F A 0.0000
45 K A -1.6018
46 T A -1.9738
47 S A -1.9848
48 L A 0.0000
49 K A -3.0202
50 D A -3.2115
51 D A -2.4245
52 P A -1.6884
53 S A -1.1342
54 Q A -1.8310
55 S A 0.0000
56 A A -1.0967
57 N A -1.9306
58 L A -1.6445
59 L A 0.0000
60 A A -1.9768
61 E A -3.0328
62 A A 0.0000
63 K A -2.9723
64 K A -3.2969
65 L A -2.0658
66 N A 0.0000
67 D A -3.2032
68 A A -1.9049
69 Q A -1.9822
70 A A -1.5257
71 P A -1.2672
72 K A -1.7970
73 V A 0.0035
74 D A -1.5097
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018