Project name: 6-1

Status: done

Started: 2026-05-26 06:01:14
Settings
Chain sequence(s) A: MGSSHHHHHHSSGKPHIDNYLHEKDKEDKIEQYDKEQKAQAAKDPKMKKKPEIPKDKSKVAGYIEIPDANIKEPVYPGPATREQLNRGVSFAEADESLEDQNISIAGHTFIDRPNYQFTNLKAAKKGSKVYFKVGDEVREYKMTSIRNVKPTAVEVLDEQEGKDKQLTLITCDDYNEETGVWETRKIFVATEVKAE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:09)
[INFO]       Main:     Simulation completed successfully.                                          (00:07:10)
Show buried residues

Minimal score value
-4.9071
Maximal score value
0.9977
Average score
-1.5639
Total score value
-306.5334

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.7468
2 G A -0.2546
3 S A -0.6932
4 S A -1.2231
5 H A -2.1289
6 H A -2.4861
7 H A -2.7278
8 H A -2.7218
9 H A -2.5070
10 H A -2.1569
11 S A -1.6330
12 S A -1.5042
13 G A -1.7994
14 K A -2.2973
15 P A -2.0196
16 H A -1.3050
17 I A -0.0794
18 D A -1.6391
19 N A -1.3211
20 Y A 0.0854
21 L A -0.2843
22 H A -1.7337
23 E A -2.3611
24 K A -3.2472
25 D A -3.8154
26 K A -3.5584
27 E A -4.3337
28 D A -4.9071
29 K A -4.2230
30 I A 0.0000
31 E A -4.5902
32 Q A -4.2522
33 Y A 0.0000
34 D A -3.9653
35 K A -4.4582
36 E A -4.3890
37 Q A -3.8809
38 K A -4.0964
39 A A -3.0463
40 Q A -3.7219
41 A A -3.1671
42 A A -2.1251
43 K A -2.6845
44 D A -2.4151
45 P A -2.1601
46 K A -2.3509
47 M A -1.9705
48 K A -3.4946
49 K A -3.8191
50 K A -3.8378
51 P A -3.1483
52 E A -2.8821
53 I A -1.7816
54 P A -2.1699
55 K A -2.9099
56 D A -2.7386
57 K A -2.7395
58 S A -2.2985
59 K A -2.6952
60 V A -1.2824
61 A A 0.0000
62 G A 0.0000
63 Y A 0.0000
64 I A 0.0000
65 E A -1.5860
66 I A 0.0000
67 P A -1.9742
68 D A -3.0368
69 A A 0.0000
70 N A -2.4404
71 I A 0.0000
72 K A -1.7539
73 E A 0.0000
74 P A 0.0000
75 V A 0.0000
76 Y A 0.0000
77 P A 0.0000
78 G A 0.0000
79 P A -1.5787
80 A A -1.2075
81 T A -1.7316
82 R A -2.9045
83 E A -3.3561
84 Q A 0.0000
85 L A 0.0000
86 N A -2.8371
87 R A -2.6270
88 G A 0.0000
89 V A 0.0000
90 S A 0.0000
91 F A 0.0000
92 A A -1.0016
93 E A -2.1800
94 A A -1.9285
95 D A -2.3422
96 E A -1.8846
97 S A -1.8467
98 L A 0.0000
99 E A -2.6729
100 D A -2.4027
101 Q A 0.0000
102 N A 0.0000
103 I A 0.0000
104 S A 0.0000
105 I A 0.0000
106 A A 0.0000
107 G A 0.0000
108 H A 0.0000
109 T A -0.1443
110 F A 0.7554
111 I A 0.9977
112 D A -0.9896
113 R A -1.3138
114 P A -0.9135
115 N A -1.4394
116 Y A -0.5648
117 Q A 0.0000
118 F A 0.0000
119 T A 0.0000
120 N A -1.2780
121 L A 0.0000
122 K A -2.2735
123 A A -1.9594
124 A A 0.0000
125 K A -3.3095
126 K A -2.8174
127 G A -2.3062
128 S A 0.0000
129 K A -2.2376
130 V A 0.0000
131 Y A -0.3646
132 F A 0.0000
133 K A -0.4425
134 V A 0.0000
135 G A -2.8210
136 D A -3.4035
137 E A -1.7446
138 V A 0.4868
139 R A -0.3301
140 E A -1.1917
141 Y A 0.0000
142 K A -2.0143
143 M A 0.0000
144 T A -1.1697
145 S A -0.8166
146 I A -1.1391
147 R A -1.9578
148 N A -2.5001
149 V A 0.0000
150 K A -2.1878
151 P A -1.1462
152 T A -0.4371
153 A A -0.2441
154 V A 0.4310
155 E A -1.6383
156 V A -0.8076
157 L A -1.3617
158 D A -3.1636
159 E A -4.0858
160 Q A -3.7704
161 E A -3.8901
162 G A -3.0279
163 K A -4.0163
164 D A -3.8280
165 K A -3.4844
166 Q A -1.8966
167 L A 0.0000
168 T A 0.0000
169 L A 0.0000
170 I A 0.0000
171 T A 0.0000
172 C A -0.8534
173 D A -1.6831
174 D A -2.3935
175 Y A -1.8657
176 N A -2.3196
177 E A -2.8842
178 E A -2.7126
179 T A -1.5225
180 G A -1.3628
181 V A -0.5094
182 W A -1.4414
183 E A -2.4896
184 T A -2.2898
185 R A 0.0000
186 K A -2.0812
187 I A 0.0000
188 F A 0.0000
189 V A -0.2405
190 A A 0.0000
191 T A -1.7751
192 E A -2.0029
193 V A -1.6245
194 K A -2.4426
195 A A -1.6359
196 E A -2.1521
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018