Project name: query_structure

Status: done

Started: 2026-03-16 23:37:09
Settings
Chain sequence(s) A: GSSVSSVPTKLEVVAATPTSLLISWDASSSSVSHYHITYGETGGNSPVQEFTVPGSSSTATISGLSPGVDYTITVYAFYSDDDLYFAFSPSSINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:21)
Show buried residues

Minimal score value
-2.9475
Maximal score value
2.7692
Average score
-0.3745
Total score value
-36.3256

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.4150
2 S A -0.0590
3 S A 0.3278
4 V A 1.1929
5 S A 0.2430
6 S A -0.0266
7 V A -0.1438
8 P A 0.0000
9 T A -1.2901
10 K A -2.3955
11 L A 0.0000
12 E A -1.7044
13 V A 0.1907
14 V A 1.5807
15 A A 0.9143
16 A A 0.2929
17 T A -0.3898
18 P A -0.8120
19 T A -0.5263
20 S A -0.3182
21 L A 0.0000
22 L A 0.7549
23 I A 0.0000
24 S A -0.6542
25 W A 0.0000
26 D A -2.2377
27 A A -1.1246
28 S A -0.8009
29 S A -0.5514
30 S A -0.4024
31 S A -0.6775
32 V A 0.0000
33 S A -0.4160
34 H A -0.3228
35 Y A 0.0000
36 H A -0.2801
37 I A 0.0000
38 T A -0.5650
39 Y A 0.0000
40 G A 0.0000
41 E A -1.2677
42 T A -1.1835
43 G A -1.2042
44 G A -1.3026
45 N A -1.5027
46 S A -0.8063
47 P A -0.3263
48 V A 0.3903
49 Q A -0.9465
50 E A -1.6529
51 F A -0.5974
52 T A -0.2133
53 V A -0.0730
54 P A -0.4103
55 G A -0.4529
56 S A -0.4509
57 S A -0.4588
58 S A -0.6072
59 T A -0.1956
60 A A 0.0000
61 T A 0.2463
62 I A 0.0000
63 S A -0.4743
64 G A -0.6857
65 L A 0.0000
66 S A -0.8275
67 P A -0.9914
68 G A -1.0679
69 V A -0.8954
70 D A -1.8006
71 Y A 0.0000
72 T A -0.7481
73 I A 0.0000
74 T A -0.4384
75 V A 0.0000
76 Y A 0.4527
77 A A 0.0000
78 F A 0.9786
79 Y A 0.0000
80 S A -0.8655
81 D A -2.1539
82 D A -2.9475
83 D A -1.9178
84 L A 0.8591
85 Y A 2.0144
86 F A 2.7692
87 A A 1.9819
88 F A 1.5594
89 S A 0.4097
90 P A 0.1213
91 S A 0.0000
92 S A -0.6666
93 I A -0.7815
94 N A -1.6983
95 Y A -1.3917
96 R A -2.3109
97 T A -1.1773
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018