Project name: query_structure

Status: done

Started: 2026-03-16 19:58:39
Settings
Chain sequence(s) A: CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:18)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:18)
Show buried residues

Minimal score value
-3.3527
Maximal score value
1.6313
Average score
-0.9959
Total score value
-35.8532

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 C A 0.2421
2 I A -0.7255
3 K A -2.8923
4 N A -2.9190
5 G A -1.7288
6 N A -1.3483
7 G A -1.1021
8 C A 0.0000
9 Q A -1.5594
10 P A -0.7668
11 N A -1.5261
12 G A -1.7376
13 S A -1.7032
14 Q A -2.1022
15 G A -1.9590
16 N A -1.4838
17 C A 0.0000
18 C A 0.3274
19 S A -0.5790
20 G A -0.4912
21 Y A -0.7459
22 C A -1.3000
23 H A -1.4706
24 K A -0.8276
25 Q A -0.7564
26 P A -0.4071
27 G A 0.0906
28 W A 1.4839
29 V A 1.6313
30 A A 0.2497
31 G A 0.0000
32 Y A -0.8105
33 C A 0.0000
34 R A -2.5871
35 R A -3.3527
36 K A -2.9960
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018