Project name: b05ada69e1e417a

Status: done

Started: 2025-02-25 17:05:05
Settings
Chain sequence(s) A: SAAQLPKAWDWRNISGVNYASTTRNQHIPQYCGSCWAMGSTSAMADRINIKRKAAWPSAYLSAQEVIDCGGAGSCDGGDDGAVWAYANKAGIPDETCNNYQAKNQDCQEFNKCGTCTTFGECKQLSTYNVWKVGDYGSVKGRTNMMAEIYKNGPISCSIMATDKLEAYTGGIFAE
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:43)
Show buried residues

Minimal score value
-3.0278
Maximal score value
2.6038
Average score
-0.7264
Total score value
-127.1163

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
12 S A -0.6105
13 A A -0.8118
14 A A -0.6712
15 Q A -1.2862
16 L A -0.7542
17 P A -0.7802
18 K A -1.6438
19 A A -0.6077
20 W A -0.3562
21 D A -1.3718
22 W A -1.4584
23 R A -2.9666
24 N A -2.5379
25 I A -1.0805
26 S A -0.7753
27 G A -1.1149
28 V A -1.0853
29 N A -2.2307
30 Y A -1.6847
31 A A -1.1776
32 S A -0.5325
33 T A -0.2997
34 T A -0.6123
35 R A -1.0755
36 N A -0.9792
37 Q A -0.5100
38 H A -0.0753
39 I A 0.8856
40 P A 0.1202
41 Q A -0.2368
42 Y A 0.5076
43 C A 0.0000
44 G A -0.5522
45 S A 0.0000
46 C A -0.2186
47 W A 0.0000
48 A A 0.0000
49 M A 0.0000
50 G A -0.0633
51 S A 0.0000
52 T A 0.0000
53 S A -0.1814
54 A A 0.0000
55 M A 0.0000
56 A A 0.0000
57 D A -0.8144
58 R A -0.9724
59 I A 0.0000
60 N A 0.0000
61 I A -1.5309
62 K A -2.4890
63 R A -1.9369
64 K A -2.1266
65 A A -1.0527
66 A A -0.3040
67 W A 0.7652
68 P A 0.4870
69 S A 0.1847
70 A A 0.0000
71 Y A 0.2534
72 L A 0.0000
73 S A 0.0000
74 A A 0.0000
75 Q A 0.0000
76 E A 0.0000
77 V A 0.0000
78 I A 0.0000
79 D A -1.4476
80 C A -0.9818
81 G A -0.3755
82 G A -0.7453
83 A A 0.0000
84 G A -1.6391
85 S A -1.6230
86 C A -1.3393
87 D A -2.0296
88 G A -1.5800
89 G A -1.8941
90 D A -2.3405
91 D A -1.4080
92 G A -0.9132
93 A A -0.9960
94 V A 0.0000
95 W A -0.8740
96 A A -0.9039
97 Y A -0.8100
98 A A 0.0000
99 N A -1.7274
100 K A -2.0829
101 A A -0.9350
102 G A 0.0000
103 I A 0.0000
104 P A 0.0000
105 D A -0.6785
106 E A -0.7184
107 T A -0.6490
108 C A 0.0000
109 N A 0.0000
110 N A -1.4998
111 Y A -0.8355
112 Q A -1.1028
113 A A 0.0000
114 K A -1.6361
115 N A -2.3217
116 Q A -2.0467
117 D A -2.5737
118 C A -1.7865
119 Q A -2.5426
120 E A -2.8887
121 F A -1.5155
122 N A -1.7728
123 K A -1.6220
124 C A 0.0000
125 G A -1.1120
126 T A -0.3852
127 C A 0.0486
128 T A -0.0771
129 T A 0.4150
130 F A 1.3443
131 G A -0.2733
132 E A -1.2385
133 C A -0.6688
134 K A -2.1211
135 Q A -2.0554
136 L A -0.7596
137 S A -0.7026
138 T A -0.1902
139 Y A -0.2087
140 N A -0.9426
141 V A -0.0698
142 W A -0.4361
143 K A -1.7861
144 V A -1.3159
145 G A -1.6901
146 D A -1.7272
147 Y A -0.5334
148 G A -0.3926
149 S A -0.0904
150 V A -0.3756
151 K A -1.9072
152 G A -2.0319
153 R A -2.4463
154 T A -1.5459
155 N A -1.6965
156 M A -0.9282
157 M A -0.6879
158 A A -1.0103
159 E A -0.6846
160 I A -0.1263
161 Y A -0.2640
162 K A -1.5913
163 N A -1.3449
164 G A 0.0000
165 P A -0.0354
166 I A 0.5000
167 S A 0.5669
168 C A 0.9111
169 S A 0.9418
170 I A 2.6038
171 M A 2.0645
172 A A 0.1623
173 T A -1.3873
174 D A -3.0278
175 K A -2.9223
176 L A -1.5580
177 E A -2.5608
178 A A -1.3856
179 Y A -0.0755
180 T A -0.0564
181 G A 0.1485
182 G A 0.7214
183 I A 2.3299
184 F A 1.5206
185 A A 0.0039
186 E A -1.7702
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018