Project name: query_structure

Status: done

Started: 2026-03-17 01:28:06
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYHITYGETGGFAGHQEFTVPGSKSTATISGLKPGVDYTITVYAYYQPYVSWAKRYSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-2.5517
Maximal score value
1.7975
Average score
-0.4446
Total score value
-42.6831

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7975
2 S A 0.7962
3 S A 0.6026
4 V A 0.4932
5 P A 0.0000
6 T A -1.5263
7 K A -2.5517
8 L A 0.0000
9 E A -1.9112
10 V A 0.0805
11 V A 1.5186
12 A A 0.8768
13 A A 0.2901
14 T A -0.5388
15 P A -1.1367
16 T A -1.0056
17 S A -0.5459
18 L A 0.0000
19 L A 0.7049
20 I A 0.0000
21 S A -0.9432
22 W A 0.0000
23 D A -2.4546
24 A A -1.1730
25 P A 0.0640
26 A A 0.4906
27 V A 0.7889
28 T A 0.3052
29 V A 0.0000
30 V A 1.1528
31 Y A 0.5789
32 Y A 0.0000
33 H A -0.0768
34 I A 0.0000
35 T A -1.3067
36 Y A 0.0000
37 G A 0.0000
38 E A -1.4585
39 T A -1.0363
40 G A -0.3892
41 G A 0.0398
42 F A 1.3985
43 A A 0.1328
44 G A -0.9989
45 H A -1.9007
46 Q A -2.3535
47 E A -2.3603
48 F A -0.7321
49 T A -0.1728
50 V A 0.0000
51 P A -0.3997
52 G A -0.1855
53 S A -0.8759
54 K A -2.0510
55 S A -1.3707
56 T A -0.7524
57 A A 0.0000
58 T A 0.2241
59 I A 0.0000
60 S A -0.6655
61 G A -1.0301
62 L A 0.0000
63 K A -2.3690
64 P A -1.6627
65 G A -1.4433
66 V A -1.4012
67 D A -2.0899
68 Y A 0.0000
69 T A -1.1323
70 I A 0.0000
71 T A -0.4207
72 V A 0.0000
73 Y A 0.6698
74 A A 0.0000
75 Y A 0.2328
76 Y A -0.1071
77 Q A -0.8866
78 P A -0.3798
79 Y A 0.8114
80 V A 0.4504
81 S A 0.2711
82 W A 0.6946
83 A A -0.5310
84 K A -1.9757
85 R A -1.8811
86 Y A -0.0349
87 S A 0.0000
88 S A 0.0806
89 P A 0.3220
90 I A 0.1341
91 S A -0.3523
92 I A -0.7366
93 N A -1.7517
94 Y A -1.4604
95 R A -2.5304
96 T A -1.6356
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018