Project name: query_structure

Status: done

Started: 2026-03-16 23:45:45
Settings
Chain sequence(s) A: GTIPCGESCVFIPCLTSALGCSCKSKVCYKN
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:17)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:17)
Show buried residues

Minimal score value
-1.9516
Maximal score value
2.9731
Average score
0.2555
Total score value
7.9191

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 G A -0.8715
2 T A 0.1615
3 I A 1.2637
4 P A 0.2207
5 C A 0.3313
6 G A -0.1459
7 E A 0.0565
8 S A 0.3943
9 C A 1.0444
10 V A 1.7666
11 F A 2.9414
12 I A 2.9731
13 P A 1.6100
14 C A 0.0000
15 L A 1.8435
16 T A 1.0024
17 S A 0.6495
18 A A 0.9104
19 L A 1.4254
20 G A -0.0311
21 C A 0.0000
22 S A -0.6911
23 C A -0.6552
24 K A -1.9516
25 S A -1.3683
26 K A -1.2056
27 V A -0.8621
28 C A 0.0000
29 Y A -0.6445
30 K A -0.7622
31 N A -1.4865
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018