Project name: b154ff2864b3f15

Status: done

Started: 2026-05-24 13:29:18
Settings
Chain sequence(s) H: EVQLVESGGGLVQPGGSLRLSCAASGFSFGDSDMAWVRQAPGKGLEWVSRITSDGSSTDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTEELLYQNSIDDWGQGTLVTVSS
input PDB
Selected Chain(s) H
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with H chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:30)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-2.777
Maximal score value
1.871
Average score
-0.6759
Total score value
-81.7899

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E H -2.0502
2 V H -1.3326
3 Q H -1.2748
4 L H 0.0000
5 V H 1.2185
6 E H 0.0000
7 S H -0.2193
8 G H -0.8033
9 G H 0.0330
10 G H 0.5475
11 L H 1.2961
12 V H 0.0000
13 Q H -1.4556
14 P H -1.6900
15 G H -1.4941
16 G H -1.0878
17 S H -1.3111
18 L H -1.0053
19 R H -2.0724
20 L H 0.0000
21 S H -0.3676
22 C H 0.0000
23 A H -0.0565
24 A H 0.0000
25 S H -0.9786
26 G H -1.2396
27 F H -0.9862
28 S H -1.0429
29 F H 0.0000
30 G H -2.2404
31 D H -2.6490
32 S H 0.0000
33 D H 0.0000
34 M H 0.0000
35 A H 0.0000
36 W H 0.0000
37 V H 0.0000
38 R H 0.0000
39 Q H -0.3220
40 A H -0.9627
41 P H -0.9218
42 G H -1.5628
43 K H -2.0936
44 G H -0.9739
45 L H 0.6005
46 E H -0.2675
47 W H 0.3898
48 V H 0.0000
49 S H 0.0000
50 R H -0.5525
51 I H 0.0000
52 T H -1.2138
52A S H -2.0291
53 D H -2.6268
54 G H -1.5547
55 S H -0.9636
56 S H -0.8705
57 T H -0.7361
58 D H -1.4259
59 Y H -1.3439
60 A H -1.5547
61 D H -2.6118
62 S H -1.7479
63 V H 0.0000
64 K H -2.7770
65 G H -1.7632
66 R H -1.5003
67 F H 0.0000
68 T H -0.9280
69 I H 0.0000
70 S H -0.4774
71 R H -1.2846
72 D H -1.8676
73 N H -2.6643
74 S H -1.8192
75 K H -2.4959
76 N H -1.9692
77 T H 0.0000
78 L H 0.0000
79 Y H -0.4567
80 L H 0.0000
81 Q H -1.1160
82 M H 0.0000
82A N H -1.3924
82B S H -1.2385
82C L H 0.0000
83 R H -2.3511
84 A H -1.7619
85 E H -2.2342
86 D H 0.0000
87 T H -0.4312
88 A H 0.0000
89 V H 0.9173
90 Y H 0.0000
91 Y H 0.6745
92 C H 0.0000
93 A H 0.0000
94 K H 0.0000
95 T H 0.0000
96 E H -1.9031
97 E H -0.9411
98 L H 0.6270
99 L H 1.8710
100 Y H 1.4858
100A Q H -0.1193
100B N H -1.1093
100C S H -0.9592
100D I H -1.0559
101 D H -2.0601
102 D H -1.3687
103 W H -0.2310
104 G H -0.1318
105 Q H -0.6272
106 G H 0.1787
107 T H 0.6299
108 L H 1.5507
109 V H 0.0000
110 T H 0.2654
111 V H 0.0000
112 S H -0.7624
113 S H -0.5849
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018