Project name: obj1 [mutate: TY117C, WN110C] [mutate: VL5C, GM10C, VV12C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYNGQGTLVYVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	VV12C,GM10C,VL5C
Energy difference between WT (input) and mutated protein (by FoldX)	2.45483 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:21)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:24)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:46)

• Minimal score value: -3.2302
• Maximal score value: 2.1068
• Average score: -0.6453
• Total score value: -77.4399

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0043
2	V	C	-1.1677
3	Q	C	-1.6301
4	L	C	0.0000
5	L	C	0.0920	mutated: VL5C
6	E	C	-0.1399
7	S	C	-0.3836
8	G	C	-0.6121
9	G	C	0.6060
10	M	C	2.1068	mutated: GM10C
11	L	C	2.0853
12	V	C	0.0000	mutated: VV12C
13	Q	C	-1.3439
14	P	C	-1.4670
15	G	C	-1.4130
16	G	C	-1.0024
17	S	C	-1.3191
18	L	C	0.0000
19	R	C	-2.2089
20	L	C	0.0000
21	S	C	-0.5749
22	C	C	0.0000
23	A	C	-0.2914
24	A	C	0.0000
25	S	C	-0.2324
26	D	C	0.0000
27	F	C	1.5455
28	T	C	0.2523
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8868
32	Y	C	-1.2169
33	E	C	-1.0773
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.3679
40	A	C	-0.9554
41	P	C	-1.3080
42	G	C	-1.4328
43	K	C	-2.1273
44	G	C	-1.0199
45	L	C	0.4984
46	E	C	-0.3764
47	W	C	0.3453
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5839
53	G	C	-1.2458
54	S	C	-1.2287
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3028
58	T	C	0.1987
59	Y	C	0.6076
60	Y	C	-0.3488
61	A	C	-1.1282
62	D	C	-2.3201
63	S	C	-1.6643
64	V	C	0.0000
65	K	C	-2.3709
66	G	C	-1.6108
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6752
70	I	C	0.0000
71	S	C	-0.5628
72	R	C	-1.3615
73	D	C	-1.9794
74	N	C	-2.1883
75	S	C	-1.7897
76	K	C	-2.3180
77	N	C	-1.6521
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6786
81	L	C	0.0000
82	Q	C	-1.2909
83	M	C	0.0000
84	N	C	-1.3479
85	S	C	-1.2257
86	L	C	0.0000
87	R	C	-2.3934
88	A	C	-1.7833
89	E	C	-2.2409
90	D	C	0.0000
91	T	C	-0.1033
92	A	C	0.0000
93	I	C	1.1550
94	Y	C	0.0000
95	Y	C	0.1480
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-2.9587
101	D	C	-3.2302
102	G	C	-2.0111
103	F	C	-1.1502
104	N	C	-2.3471
105	K	C	-3.0454
106	G	C	-1.5928
107	F	C	-0.7191
108	D	C	-1.2074
109	Y	C	-0.9657
110	N	C	-1.3150
111	G	C	0.0000
112	Q	C	-1.3765
113	G	C	-0.3240
114	T	C	0.5728
115	L	C	1.8678
116	V	C	0.0000
117	Y	C	1.2624
118	V	C	0.0000
119	S	C	-0.7053
120	S	C	-1.0319