Project name: query_structure

Status: done

Started: 2026-03-17 00:44:05
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVTQANMYWYRQAPGKEREWVAAIDSDGMYTHYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDFGWFFWDYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:51)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:52)
Show buried residues

Minimal score value
-3.4413
Maximal score value
3.3789
Average score
-0.6781
Total score value
-81.3682

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.4890
2 V A -0.8878
3 Q A -0.8885
4 L A 0.0000
5 V A 1.1927
6 E A 0.0000
7 S A -0.5805
8 G A -1.0731
9 G A -0.8401
10 G A -0.0773
11 L A 1.0124
12 V A 0.0229
13 Q A -1.2022
14 A A -1.4130
15 G A -1.3638
16 G A -0.9405
17 S A -1.3731
18 L A -1.0701
19 R A -2.3425
20 L A 0.0000
21 S A -0.4699
22 C A 0.0000
23 A A -0.0709
24 A A 0.0000
25 S A -0.7275
26 G A -1.0978
27 F A 0.0000
28 P A -0.7999
29 V A 0.0000
30 T A -1.2785
31 Q A -0.7523
32 A A 0.0000
33 N A -1.3353
34 M A 0.0000
35 Y A -0.0368
36 W A 0.0000
37 Y A -0.3142
38 R A -1.1849
39 Q A -2.0339
40 A A -2.0326
41 P A -1.4355
42 G A -1.9448
43 K A -3.3137
44 E A -3.4413
45 R A -2.5318
46 E A -1.6564
47 W A -0.5495
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 D A -0.8308
53 S A -1.2369
54 D A -1.7217
55 G A -0.7103
56 M A 0.9286
57 Y A 1.0928
58 T A 0.3014
59 H A -0.9401
60 Y A -1.2631
61 A A 0.0000
62 D A -2.5024
63 S A -1.7361
64 V A 0.0000
65 K A -2.7338
66 G A -1.8401
67 R A -1.6570
68 F A 0.0000
69 T A -1.1773
70 I A 0.0000
71 S A -0.5704
72 R A -1.5150
73 D A -1.9835
74 N A -2.5127
75 A A -1.7238
76 K A -2.4530
77 N A -1.8503
78 T A -1.1214
79 V A 0.0000
80 Y A 0.0000
81 L A 0.0000
82 Q A -1.6583
83 M A 0.0000
84 N A -1.8985
85 S A -1.3363
86 L A 0.0000
87 K A -2.2342
88 P A -1.8881
89 E A -2.3113
90 D A 0.0000
91 T A -0.9798
92 A A 0.0000
93 V A -0.6653
94 Y A 0.0000
95 Y A -0.1092
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -2.2380
100 D A -1.8662
101 F A 0.2446
102 G A 0.9499
103 W A 2.5028
104 F A 3.3789
105 F A 3.2998
106 W A 1.8201
107 D A -0.8782
108 Y A -0.0916
109 D A -1.6107
110 Y A -0.6077
111 W A 0.0317
112 G A 0.0368
113 Q A -0.9202
114 G A 0.0000
115 T A 0.0000
116 Q A -1.2155
117 V A 0.0000
118 T A -0.3103
119 V A 0.0000
120 S A -0.7355
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018